SEMA6D antibody (N-Term)

Catalog No. ABIN635700

The Rabbit Polyclonal anti-SEMA6D antibody (ABIN635700) specifically detects SEMA6D in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for SEMA6D antibody (N-Term) (ABIN635700)

Target: SEMA6D (Sema Domain, Transmembrane Domain (TM), and Cytoplasmic Domain, (Semaphorin) 6D (SEMA6D))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SEMA6D antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SEMA6D Antibody

Binding Specificity: N-Term

Specificity: SEMA6 D antibody was raised against the N terminal of SEMA6

Purification: Affinity purified

Immunogen: SEMA6 D antibody was raised using the N terminal of SEMA6 corresponding to a region with amino acids KLYSATVADFLASDAVIYRSMGDGSALRTIKYDSKWIKEPHFLHAIEYGN

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SEMA6D Blocking Peptide, (ABIN939936), is also available for use as a blocking control in assays to test for specificity of this SEMA6D antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SEMA0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SEMA6D

Target: SEMA6D (Sema Domain, Transmembrane Domain (TM), and Cytoplasmic Domain, (Semaphorin) 6D (SEMA6D))

Alternative Name: SEMA6D

Background: Semaphorins are a large family, including both secreted and membrane associated proteins, many of which have been implicated as inhibitors or chemorepellents in axon pathfinding, fasciculation and branching, and target selection. All semaphorins possess a semaphorin (Sema) domain and a PSI domain (found in plexins, semaphorins and integrins) in the N-terminal extracellular portion. Additional sequence motifs C-terminal to the semaphoring domain allow classification into distinct subfamilies. Results demonstrate that transmembrane semaphorins, like the secreted ones, can act as repulsive axon guidance cues. SEMA6D is a class 6 vertebrate transmembrane semaphorin that demonstrates alternative splicing. Six transcript variants have been identified and expression of the distinct encoded isoforms is thought to be regulated in a tissue- and development-dependent manner.

Molecular Weight: 65 kDa (MW of target protein)

Pathways: Smooth Muscle Cell Migration