TSPAN31 antibody (Middle Region)

Catalog No. ABIN635760

The Rabbit Polyclonal anti-TSPAN31 antibody (ABIN635760) specifically detects TSPAN31 in WB. The antibody is reactive with Human samples.

Quick Overview for TSPAN31 antibody (Middle Region) (ABIN635760)

Target: TSPAN31 (Tetraspanin 31 (TSPAN31))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TSPAN31 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TSPAN31 Antibody

Binding Specificity: Middle Region

Specificity: Tetraspanin 31 antibody was raised against the middle region of TSPAN31

Purification: Affinity purified

Immunogen: Tetraspanin 31 antibody was raised using the middle region of TSPAN31 corresponding to a region with amino acids CTAICKSQSPTCQMCGEKFLKHSDEALKILGGVGLFFSFTEILGVWLAMR

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

Tetraspanin 31 Blocking Peptide, (ABIN937205), is also available for use as a blocking control in assays to test for specificity of this Tetraspanin 31 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TSPAN31 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TSPAN31

Target: TSPAN31 (Tetraspanin 31 (TSPAN31))

Alternative Name: Tetraspanin 31

Background: TSPAN31 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is thought to be involved in growth-related cellular processes. This gene is associated with tumorigenesis and osteosarcoma.

Molecular Weight: 23 kDa (MW of target protein)