TMED10 antibody

Catalog No. ABIN635823

The Rabbit Polyclonal anti-TMED10 antibody (ABIN635823) specifically detects TMED10 in WB. The antibody is reactive with Human, Mouse and Rat samples.

Quick Overview for TMED10 antibody (ABIN635823)

Target: TMED10 (Transmembrane Emp24-Like Trafficking Protein 10 (TMED10))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMED10 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMED10 Antibody

Purification: Affinity purified

Immunogen: TMED10 antibody was raised using a synthetic peptide corresponding to a region with amino acids KLKPLEVELRRLEDLSESIVNDFAYMKKREEEMRDTNESTNTRVLYFSIF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMED10 Blocking Peptide, (ABIN939901), is also available for use as a blocking control in assays to test for specificity of this TMED10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMED10

Target: TMED10 (Transmembrane Emp24-Like Trafficking Protein 10 (TMED10))

Alternative Name: TMED10

Background: This gene is a member of the EMP24/GP25L/p24 family and encodes a protein with a GOLD domain. This type I membrane protein is localized to the plasma membrane and golgi cisternae and is involved in vesicular protein trafficking.

Molecular Weight: 24 kDa (MW of target protein)