SLC9A1 antibody

Catalog No. ABIN635841

The Rabbit Polyclonal anti-SLC9A1 antibody (ABIN635841) specifically detects SLC9A1 in WB. The antibody is reactive with Human samples.

Quick Overview for SLC9A1 antibody (ABIN635841)

Target: SLC9A1 (Solute Carrier Family 9, Subfamily A (NHE1, Cation Proton Antiporter 1), Member 1 (SLC9A1))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC9A1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC9A1 Antibody

Purification: Affinity purified

Immunogen: SLC9 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids RSKETSSPGTDDVFTPAPSDSPSSQRIQRCLSDPGPHPEPGEGEPFFPKG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC9A1 Blocking Peptide, (ABIN5616281), is also available for use as a blocking control in assays to test for specificity of this SLC9A1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC0 1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC9A1

Target: SLC9A1 (Solute Carrier Family 9, Subfamily A (NHE1, Cation Proton Antiporter 1), Member 1 (SLC9A1))

Alternative Name: SLC9A1

Background: The Na+/H+ antiporter (SLC9A1) is a ubiquitous membrane-bound enzyme involved in pH regulation of vertebrate cells. It is specifically inhibited by the diuretic drug amiloride and activated by a variety of signals including growth factors and mitogens.

Molecular Weight: 91 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process, Proton Transport