Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

ADAM Metallopeptidase Domain 30 (ADAM30) antibody

Antigen

ADAM Metallopeptidase Domain 30 (ADAM30)

Synonyms svph4, MGC132801, MGC132802, 4933424D07Rik
Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN635861
Quantity 50 ug  (1 mg/ml)  (Variants)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Alternative name ADAM30
Immunogen ADAM30 antibody was raised using the N terminal of ADAM30 corresponding to a region with amino acids IEWQMAPYENKARLRDFPGSYKHPKYLELILLFDQSRYRFVNNNLSQVIH
Description ADAM30 is a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins.
Molecular Weight 66 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ADAM30 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Proteolysis / Ubiquitin, Metalloprotease, Extracellular Matrix

Alternatives

Alternatives for antigen "ADAM Metallopeptidase Domain 30 (ADAM30)", type "Antibodies"
Hosts Rabbit (6), Mouse (2)
Reactivities Human (7)
Applications Western Blotting (WB) (6), ELISA (4), Enzyme Immunoassay (EIA) (3), Flow Cytometry (FACS) (1), Immunohistochemistry (IHC) (1)
Epitopes C-Term (2)