ANTXR1 antibody (Middle Region)

Catalog No. ABIN635911

This Rabbit Polyclonal antibody specifically detects ANTXR1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for ANTXR1 antibody (Middle Region) (ABIN635911)

Target: ANTXR1 (anthrax Toxin Receptor 1 (ANTXR1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANTXR1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ANTXR1 Antibody

Binding Specificity: Middle Region

Specificity: ANTXR1 antibody was raised against the middle region of ANTXR1

Purification: Affinity purified

Immunogen: ANTXR1 antibody was raised using the middle region of ANTXR1 corresponding to a region with amino acids VRWGEKGSTEEGAKLEKAKNARVKMPEQEYEFPEPRNLNNNMRRPSSPRK

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ANTXR1 Blocking Peptide, (ABIN5612093), is also available for use as a blocking control in assays to test for specificity of this ANTXR1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANTXR1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ANTXR1

Target: ANTXR1 (anthrax Toxin Receptor 1 (ANTXR1))

Alternative Name: ANTXR1

Background: ANTXR1 is a type I transmembrane protein and is a tumor-specific endothelial marker that has been implicated in colorectal cancer. ANTXR1 has been shown to also be a docking protein or receptor for Bacillus anthracis toxin, the causative agent of the disease, anthrax.

Molecular Weight: 60 kDa (MW of target protein)