ACP2 antibody (Middle Region)

Catalog No. ABIN635914

This Rabbit Polyclonal antibody specifically detects ACP2 in WB. It exhibits reactivity toward Human, Rat and Mouse.

Quick Overview for ACP2 antibody (Middle Region) (ABIN635914)

Target: ACP2 (Acid Phosphatase 2, Lysosomal (ACP2))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ACP2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ACP2 Antibody

Binding Specificity: Middle Region

Specificity: ACP2 antibody was raised against the middle region of ACP2

Purification: Affinity purified

Immunogen: ACP2 antibody was raised using the middle region of ACP2 corresponding to a region with amino acids VPITEDRLLKFPLGPCPRYEQLQNETRQTPEYQNESSRNAQFLDMVANET

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ACP2 Blocking Peptide, (ABIN5611912), is also available for use as a blocking control in assays to test for specificity of this ACP2 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ACP2 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ACP2

Target: ACP2 (Acid Phosphatase 2, Lysosomal (ACP2))

Alternative Name: ACP2

Background: ACP2 is the beta subunit of lysosomal acid phosphatase (LAP). LAP is chemically and genetically distinct from red cell acid phosphatase. The protein belongs to a family of distinct isoenzymes which hydrolyze orthophosphoric monoesters to alcohol and phosphate. Mutations in this gene or in the related alpha subunit gene cause acid phosphatase deficiency.

Molecular Weight: 45 kDa (MW of target protein)