SLC35A3 antibody

Catalog No. ABIN635941

This Rabbit Polyclonal antibody specifically detects SLC35A3 in WB. It exhibits reactivity toward Human.

Quick Overview for SLC35A3 antibody (ABIN635941)

Target: SLC35A3 (Solute Carrier Family 35 (UDP-N-Acetylglucosamine (UDP-GlcNAc) Transporter), Member A3 (SLC35A3))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SLC35A3 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SLC35A3 Antibody

Purification: Affinity purified

Immunogen: SLC35 A3 antibody was raised using a synthetic peptide corresponding to a region with amino acids VAFVQWPSDSQLDSKELSAGSQFVGLMAVLTACFSSGFAGVYFEKILKET

Application Details

Application Notes: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SLC35A3 Blocking Peptide, (ABIN5616235), is also available for use as a blocking control in assays to test for specificity of this SLC35A3 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 3 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SLC35A3

Target: SLC35A3 (Solute Carrier Family 35 (UDP-N-Acetylglucosamine (UDP-GlcNAc) Transporter), Member A3 (SLC35A3))

Alternative Name: SLC35A3

Background: SLC35A3 is a uridine diphosphate-N-acetylglucosamine transporter in the Golgi apparatus.

Molecular Weight: 36 kDa (MW of target protein)