TMED1 antibody (Middle Region)

Catalog No. ABIN635968

This Rabbit Polyclonal antibody specifically detects TMED1 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for TMED1 antibody (Middle Region) (ABIN635968)

Target: TMED1 (Transmembrane Emp24 Protein Transport Domain Containing 1 (TMED1))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TMED1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TMED1 Antibody

Binding Specificity: Middle Region

Specificity: TMED1 antibody was raised against the middle region of TMED1

Purification: Affinity purified

Immunogen: TMED1 antibody was raised using the middle region of TMED1 corresponding to a region with amino acids FTLESPQGVLLVSESRKADGVHTVEPTEAGDYKLCFDNSFSTISEKLVFF

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TMED1 Blocking Peptide, (ABIN938481), is also available for use as a blocking control in assays to test for specificity of this TMED1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMED1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TMED1

Target: TMED1 (Transmembrane Emp24 Protein Transport Domain Containing 1 (TMED1))

Alternative Name: TMED1

Background: TMED1 was identified by its interaction with interleukin 1 receptor-like 1 (IL1RL1). This protein lacks any similarity to other interleukin 1 ligands. The functional significance of its interaction with IL1RL1 is not known.

Molecular Weight: 23 kDa (MW of target protein)