DNAJB9 antibody

Catalog No. ABIN635974

This Rabbit Polyclonal antibody specifically detects DNAJB9 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for DNAJB9 antibody (ABIN635974)

Target: DNAJB9 (Microvascular Endothelial Differentiation Gene 1 Protein (DNAJB9))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DNAJB9 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DNAJB9 Antibody

Purification: Affinity purified

Immunogen: DNAJB9 antibody was raised using a synthetic peptide corresponding to a region with amino acids MATPQSIFIFAICILMITELILASKSYYDILGVPKSASERQIKKAFHKLA

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

DNAJB9 Blocking Peptide, (ABIN5613231), is also available for use as a blocking control in assays to test for specificity of this DNAJB9 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DNAJB9 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for DNAJB9

Target: DNAJB9 (Microvascular Endothelial Differentiation Gene 1 Protein (DNAJB9))

Alternative Name: DNAJB9

Background: DNAJB9 acts as a co-chaperone with an Hsp70 protein.

Molecular Weight: 25 kDa (MW of target protein)

Pathways: ER-Nucleus Signaling