SDF4 antibody (Middle Region)

Catalog No. ABIN635983

This Rabbit Polyclonal antibody specifically detects SDF4 in WB. It exhibits reactivity toward Human.

Quick Overview for SDF4 antibody (Middle Region) (ABIN635983)

Target: SDF4 (Stromal Cell Derived Factor 4 (SDF4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SDF4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SDF4 Antibody

Binding Specificity: Middle Region

Specificity: SDF4 antibody was raised against the middle region of SDF4

Purification: Affinity purified

Immunogen: SDF4 antibody was raised using the middle region of SDF4 corresponding to a region with amino acids KTHFRAVDPDGDGHVSWDEYKVKFLASKGHSEKEVADAIRLNEELKVDEE

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

SDF4 Blocking Peptide, (ABIN940063), is also available for use as a blocking control in assays to test for specificity of this SDF4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SDF4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for SDF4

Target: SDF4 (Stromal Cell Derived Factor 4 (SDF4))

Alternative Name: SDF4

Background: SDF4 may regulate calcium-dependent activities in the endoplasmic reticulum lumen or post-ER compartment.

Molecular Weight: 39 kDa (MW of target protein)