Add to Basket
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

ARMCX3 antibody

Antigen

ARMCX3

Clonality Polyclonal
Host
Alternatives

Rabbit

Application
Alternatives Western Blotting (WB)
Catalog no. ABIN635988
Quantity 50 ug  (1 mg/ml)
Price 478.33 $   Plus shipping costs $35.00
Shipping to
Availability Ships within 5 to 7 Business Days

Additional Information

Immunogen ARMCX3 antibody was raised using the middle region of ARMCX3 corresponding to a region with amino acids LFSAGNEETKLQVLKLLLNLAENPAMTRELLRAQVPSSLGSLFNKKENKE
Description ARMCX3 is a member of the ALEX family of proteins which may play a role in tumor suppression. The encoded protein contains a potential N-terminal transmembrane domain and a single Armadillo (arm) repeat. Other proteins containing the arm repeat are involved in development, maintenance of tissue integrity, and tumorigenesis.
Molecular Weight 42 kDa (MW of target protein)

Application Details

Concentration 1 mg/ml
Purification Affinity purified
Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of ARMCX3 antibody in PBS
Storage Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C. Avoid repeat freeze-thaw cycles.
Research Area Cancer, Transcription Factors

Alternatives

Alternatives for antigen "ARMCX3", type "Antibodies"
Hosts Rabbit (20), Mouse (1)
Reactivities Human (20), Mouse (Murine) (20), Rat (Rattus) (19), Chicken (1), Fruit Fly (Drosophila melanogaster) (1), Pig (Porcine) (1), Sheep (Ovine) (1)
Applications Flow Cytometry (FACS) (18), Immunofluorescence (IF) (18), ELISA (4), Western Blotting (WB) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (2), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (2), Immunoprecipitation (IP) (2), Immunoelectron Microscopy (IEM) (1)
Conjugates Alexa Flour 488 (1), Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1), RBITC (1)