RDH10 antibody

Catalog No. ABIN636035

The Rabbit Polyclonal anti-RDH10 antibody is suitable to detect RDH10 in samples from Human, Rat and Mouse. It has been validated for WB.

Quick Overview for RDH10 antibody (ABIN636035)

Target: RDH10 (Retinol Dehydrogenase 10 (All-Trans) (RDH10))

Reactivity: Human, Rat, Mouse

Host: Rabbit

Clonality: Polyclonal

Conjugate: This RDH10 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-RDH10 Antibody

Purification: Affinity purified

Immunogen: RDH10 antibody was raised using a synthetic peptide corresponding to a region with amino acids QSNEETAGMVRHIYRDLEAADAAALQAGNGEEEILPHCNLQVFTYTCDVG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

RDH10 Blocking Peptide, (ABIN5615818), is also available for use as a blocking control in assays to test for specificity of this RDH10 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of RDH10 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for RDH10

Target: RDH10 (Retinol Dehydrogenase 10 (All-Trans) (RDH10))

Alternative Name: RDH10

Background: RDH10 is a retinol dehydrogenase with a clear preference for NADP. RDH10 converts all-trans-retinol to all-trans-retinal. RDH10 has no detectable activity towards 11-cis-retinol, 9-cis-retinol and 13-cis-retinol.RDH10 generates all-trans retinal from all-trans retinol and may plan an important role in the photic visual cycle.

Molecular Weight: 38 kDa (MW of target protein)