TM4SF4 antibody (N-Term)

Catalog No. ABIN636043

This Rabbit Polyclonal antibody specifically detects TM4SF4 in WB. It exhibits reactivity toward Human.

Quick Overview for TM4SF4 antibody (N-Term) (ABIN636043)

Target: TM4SF4 (Transmembrane 4 Superfamily Member 4 (TM4SF4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This TM4SF4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-TM4SF4 Antibody

Binding Specificity: N-Term

Specificity: TM4 SF4 antibody was raised against the N terminal of TM4 F4

Purification: Affinity purified

Immunogen: TM4 SF4 antibody was raised using the N terminal of TM4 F4 corresponding to a region with amino acids CTGGCARCLGGTLIPLAFFGFLANILLFFPGGKVIDDNDHLSQEIWFFGG

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

TM4SF4 Blocking Peptide, (ABIN937208), is also available for use as a blocking control in assays to test for specificity of this TM4SF4 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TM0 F4 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for TM4SF4

Target: TM4SF4 (Transmembrane 4 Superfamily Member 4 (TM4SF4))

Alternative Name: TM4SF4

Background: TM4SF4 is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This protein is a cell surface glycoprotein that can regulate cell proliferation.

Molecular Weight: 21 kDa (MW of target protein)