APOB antibody (Middle Region)

Catalog No. ABIN636056

The Rabbit Polyclonal anti-APOB antibody is suitable to detect APOB in samples from Human. It has been validated for WB.

Quick Overview for APOB antibody (Middle Region) (ABIN636056)

Target: APOB (Apolipoprotein B (APOB))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This APOB antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-APOB Antibody

Binding Specificity: Middle Region

Specificity: ApoB antibody was raised against the middle region of APOB

Purification: Affinity purified

Immunogen: ApoB antibody was raised using the middle region of APOB corresponding to a region with amino acids SPDKKLTIFKTELRVRESDEETQIKVNWEEEAASGLLTSLKDNVPKATGV

Application Details

Application Notes: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ApoB Blocking Peptide, (ABIN5612112), is also available for use as a blocking control in assays to test for specificity of this ApoB antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of APOB antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for APOB

Target: APOB (Apolipoprotein B (APOB))

Alternative Name: ApoB

Background: This gene product is the main apolipoprotein of chylomicrons and low density lipoproteins. It occurs in plasma as two main isoforms, apoB-48 and apoB-100: the former is synthesized exclusively in the gut and the latter in the liver.

Molecular Weight: 241 kDa (MW of target protein)

Pathways: Lipid Metabolism