Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN785183

Exophilin 5 (EXPH5) (Middle Region) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms Slac2b, slac2-b, Kiaa0624, E030050P12, B130009M24Rik, AC079869.22gm5, SLAC2-B, SLAC2B, RGD1560308, KDELC2, DKFZp469K2410
Epitope
»Alternatives Middle Region
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN785183
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-EXPH5 antibody: synthetic peptide directed towards the middle region of human EXPH5
Sequence QGRLWKPSFLKNPGFLKDDLRNPPNPSESLSSNSPSSQVP EDGLSPSEPL
Predicted Reactivity Human : 100%, Bovine : 85%, Horse : 85%, Dog : 78%
Characteristics This is a rabbit polyclonal antibody against EXPH5. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name EXPH5
Background The function of this protein remains unknown.
Molecular Weight 222kDa
Gene ID 23086
NCBI Accession NP_055880, NM_015065
UniProt Q149M6
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-EXPH5 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Alternatives for antigen "Exophilin 5 (EXPH5)", type "Antibodies"
Hosts (2)
Reactivities (1)
Applications (2), (1)
Epitopes (1)
Beacon