Did you know that you can buy products from over 140 different suppliers from us?

Exophilin 5 (EXPH5) (Middle Region) antibody

Details for Product No. ABIN785183
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Synonyms KDELC2, DKFZp469K2410, SLAC2-B, SLAC2B, AC079869.22gm5, B130009M24Rik, E030050P12, Kiaa0624, Slac2b, slac2-b, RGD1560308
Epitope
Middle Region
(1)
Reactivity
Human
(1)
Host
Rabbit
(2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(2)
Pubmed 1 reference available
Quantity 50 µg
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Catalog No. ABIN785183
289.00 $
Plus shipping costs $45.00

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human EXPH5
Sequence QGRLWKPSFLKNPGFLKDDLRNPPNPSESLSSNSPSSQVP EDGLSPSEPL
Predicted Reactivity Human : 100 %, Bovine : 80 %, Horse : 80 %, Dog : 70 %
Characteristics This is a rabbit polyclonal antibody against EXPH5. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name EXPH5
Background The function of this protein remains unknown.
Molecular Weight 222 kDa
Gene ID 23086
NCBI Accession NM_015065, NP_055880
UniProt Q149M6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1989 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Exophilin 5 (EXPH5) (Middle Region) antibody WB Suggested Anti-EXPH5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: ACHN cell lysate
anti-Exophilin 5 (EXPH5) (Middle Region) antibody (2) Human sperm extract
anti-Exophilin 5 (EXPH5) (Middle Region) antibody (3) WB Suggested Anti-EXPH5
Antibody Titration: 0.2-1 µg/mL ELISA Titer: 1:.12500
Positive Control: ACHN cell lysate
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Validation Images
back to top