Exophilin 5 (EXPH5) (Middle Region) antibody

Details for Product No. ABIN785183
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Synonyms Slac2b, slac2-b, Kiaa0624, E030050P12, B130009M24Rik, AC079869.22gm5, SLAC2-B, SLAC2B, RGD1560308, KDELC2, DKFZp469K2410
Epitope
Middle Region
(1)
Reactivity
Human
(1)
Host
Rabbit
(2)
Clonality
Polyclonal
Application
Western Blotting (WB)
(2)
Pubmed 1 reference available
Catalog no. ABIN785183
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the middle region of human EXPH5
Sequence QGRLWKPSFLKNPGFLKDDLRNPPNPSESLSSNSPSSQVP EDGLSPSEPL
Predicted Reactivity Human : 100 %, Bovine : 80 %, Horse : 80 %, Dog : 70 %
Characteristics This is a rabbit polyclonal antibody against EXPH5. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name EXPH5
Background The function of this protein remains unknown.
Molecular Weight 222 kDa
Gene ID 23086
NCBI Accession NM_015065, NP_055880
UniProt Q149M6
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 1989 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Supplier Images
anti-Exophilin 5 (EXPH5) (Middle Region) antibody WB Suggested Anti-EXPH5 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: ACHN cell lysate
Background publications Colland, Jacq, Trouplin et al.: "Functional proteomics mapping of a human signaling pathway." in: Genome research, Vol. 14, Issue 7, pp. 1324-32, 2004 (PubMed).

Hosts (2)
Reactivities (1)
Applications (2)
Epitopes (1)
back to top