Add to Basket Bulk discount
Order hotline:
+1 404 474 4654
+1 888 205 9894 (TF)

Pleckstrin Homology-Like Domain, Family A, Member 1 (PHLDA1) (Center) antibody

Antigen

Pleckstrin Homology-Like Domain, Family A, Member 1 (PHLDA1)
Synonyms Tdag, TDAG51, DT1P1B11, PHRIP, MGC131738
Binding Site
Alternatives

Center
Clonality Polyclonal
Host
Alternatives

Rabbit
Reactivity
Alternatives

Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Conjugate
Alternatives Un-conjugated
Application
Alternatives Western Blotting (WB)
2 references available
Catalog no. ABIN785710
Quantity 50 µg
Price 317.90 $   Plus shipping costs $45.00
Bulk discount
Shipping to
Availability Will be delivered in 2 to 3 Business Days

anti-Pleckstrin Homology-Like Domain, Family A, Member 1 (PHLDA1) (Center) antibody

Additional Information
Application Details Publications Images Alternatives back to top

Alternative name TDAG51 / PHLDA1
Gene ID PHLDA1
Immunogen The immunogen for anti-PHLDA1 antibody: synthetic peptide directed towards the middle region of human PHLDA1
Sequence PAVASLEPPVKLKELHFSNMKTVDCVERKGKYMYFTVVMA EGKEIDFRCP
Cross-Reactivity Cow (Bovine), Human, Mouse (Murine), Rat (Rattus)
Format Lyophilized
Reconstitution Add 50 µl of distilled water. Final anti-PHLDA1 antibody concentration is 1 mg/ml.
Description PHLDA1 is an evolutionarily conserved proline-histidine rich nuclear protein. It may play an important role in the anti-apoptotic effects of insulin-like growth factor-1.This gene encodes an evolutionarily conserved proline-histidine rich nuclear protein. The encoded protein may play an important role in the anti-apoptotic effects of insulin-like growth factor-1.
Characteristics Antigen Size: 401 amino acids
Molecular Weight 45kDa

Application Details
Publications Images Alternatives back to top

Application Notes WB Suggested Anti-PHLDA1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Human Placenta.
Purification Affinity Purified
Buffer PBS
Storage (Long Term) For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.
Storage (Short Term) Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.
Restrictions For Research Use only

Publications
Application Details Images Alternatives back to top

Product Nagai, Fregnani, Netto et al.: "Down-regulation of PHLDA1 gene expression is associated with breast cancer progression." in: Breast cancer research and treatment, Vol. 106, Issue 1, pp. 49-56, 2007 (PubMed).

Tsuda, Davis, Argani et al.: "TFE3 fusions activate MET signaling by transcriptional up-regulation, defining another class of tumors as candidates for therapeutic MET inhibition." in: Cancer research, Vol. 67, Issue 3, pp. 919-29, 2007 (PubMed).

Alternatives
Application Details Publications Images back to top

Alternatives for antigen "Pleckstrin Homology-Like Domain, Family A, Member 1 (PHLDA1)", type "Antibodies"
Hosts Rabbit (31)
Reactivities Human (29), Rat (Rattus) (22), Mouse (Murine) (21), Cow (Bovine) (20), Dog (Canine) (19), Cat (Feline) (1), Chicken (1), Xenopus laevis (1)
Applications Immunofluorescence (IF) (16), Western Blotting (WB) (16), ELISA (10), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)) (4), Immunohistochemistry (Formalin-fixed Sections) (IHC (f)) (3), Immunoprecipitation (IP) (2), Immunocytochemistry (ICC) (1), Immunoelectron Microscopy (IEM) (1), Immunohistochemistry (IHC) (1)
Conjugates Alexa Fluor 350 (1), Alexa Fluor 488 (1), Alexa Fluor 555 (1), Alexa Fluor 647 (1), Biotin (1), Cy3 (1), Cy5 (1), Cy5.5 (1), Cy7 (1), FITC (1), Gold (1), HRP (1), PE (1), PE,Cy3 (1), PE,Cy5 (1), PE,Cy5.5 (1), PE,Cy7 (1)
Epitopes C-Term (21), Internal Region (1), N-Term,AA 22-49 (1)