Zinc Finger Protein 550 (ZNF550) (N-Term) antibody

Details for Product No. ABIN972053
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
N-Term
(5), (2), (1), (1), (1), (1)
Reactivity
Human
(14), (1), (1), (1), (1), (1)
Host
Rabbit
(13), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(14), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN972053
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF550
Sequence LLVSLGDRAQVHTREPTTYPPVLSERAFLRGSLTLESSTS SDSRLGRARD
Predicted Reactivity Human :100 %
Characteristics This is a rabbit polyclonal antibody against ZNF550. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF550
Background ZNF550 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 8 C2H2-type zinc fingers and 1 KRAB domain. ZNF550 may be involved in transcriptional regulation.
Molecular Weight 44 kDa
Gene ID 162972
NCBI Accession NM_001039654, NP_001034743
UniProt Q7Z398
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 381 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Rush, Moritz, Lee et al.: "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." in: Nature biotechnology, Vol. 23, Issue 1, pp. 94-101, 2005 (PubMed).

Hosts (13), (1)
Reactivities (14), (1), (1), (1), (1), (1)
Applications (14), (1), (1)
Epitopes (5), (2), (1), (1), (1), (1)
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Validation Images
back to top