Search, Find and Buy Antibodies, ELISA Kits and Proteins.
Loading Loading
Order hotline:
phone +1 404 474 4654
fax +1 888 205 9894 (TF)
Details for Product No. ABIN972053

Zinc Finger Protein 550 (ZNF550) (N-Term) antibody

Request
Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

Antigen
Epitope
»Alternatives N-Term
Reactivity
»Alternatives Human
Host
»Alternatives Rabbit
Clonality Polyclonal
Application
»Alternatives Western Blotting (WB)
Pubmed 1 reference available
Catalog no. ABIN972053
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Shipping to
Availability Will be delivered in 2 to 3 Business Days
Immunogen The immunogen for anti-ZNF550 antibody: synthetic peptide directed towards the N terminal of human ZNF550
Sequence LLVSLGDRAQVHTREPTTYPPVLSERAFLRGSLTLESSTS SDSRLGRARD
Predicted Reactivity Human :100%
Characteristics This is a rabbit polyclonal antibody against ZNF550. It was validated on Western Blot using a cell lysate as a positive control. We strive to provide antibodies covering each member of a whole protein family of your interest.
Purification Affinity Purified
Alternative Name ZNF550
Background ZNF550 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 8 C2H2-type zinc fingers and 1 KRAB domain. ZNF550 may be involved in transcriptional regulation.
Molecular Weight 44kDa
Gene ID 162972
NCBI Accession NP_001034743, NM_001039654
UniProt Q7Z398
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water
Concentration 1mg/mL
Buffer Final anti-ZNF550 antibody concentration is 1 mg/mL in PBS buffer.
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Background publications Rush, Moritz, Lee et al.: "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." in: Nature biotechnology, Vol. 23, Issue 1, pp. 94-101, 2005 (PubMed).

Alternatives for antigen "Zinc Finger Protein 550 (ZNF550)", type "Antibodies"
Hosts (13), (1)
Reactivities (14), (1), (1), (1), (1), (1)
Applications (14), (1), (1), (1)
Epitopes (6), (2), (1), (1), (1), (1)
Beacon