Zinc Finger Protein 550 (ZNF550) (N-Term) antibody

Details for Product No. ABIN972053
Request Want additional data for this product?

The Independent Validation Initiative strives to provide you with high quality data. Find out more

 
Antigen
Epitope
N-Term
(5), (2), (1), (1), (1), (1)
Reactivity
Human
(14), (1), (1), (1), (1), (1)
Host
Rabbit
(13), (1)
Clonality
Polyclonal
Application
Western Blotting (WB)
(14), (1), (1)
Pubmed 1 reference available
Catalog no. ABIN972053
Quantity 50 µg
Price
289.00 $   Plus shipping costs $45.00
Options
Shipping to United States (Change)
Availability Will be delivered in 2 to 3 Business Days

Order hotline:

  • +1 404 474 4654
  • +1 888 205 9894 (TF)
Immunogen Synthetic peptide directed towards the N terminal of human ZNF550
Sequence LLVSLGDRAQVHTREPTTYPPVLSERAFLRGSLTLESSTS SDSRLGRARD
Predicted Reactivity Human :100 %
Characteristics This is a rabbit polyclonal antibody against ZNF550. It was validated on Western Blot using a cell lysate as a positive control.
Purification Affinity Purified
Alternative Name ZNF550
Background ZNF550 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 8 C2H2-type zinc fingers and 1 KRAB domain. ZNF550 may be involved in transcriptional regulation.
Molecular Weight 44 kDa
Gene ID 162972
NCBI Accession NM_001039654, NP_001034743
UniProt Q7Z398
Research Area Chromatin and Nuclear Signaling, Transcription Factors
Application Notes Optimal working dilutions should be determined experimentally by the investigator.
Comment

Antigen size: 381 AA

Restrictions For Research Use only
Format Lyophilized
Reconstitution Add 50 µL of distilled water.
Concentration 1 mg/mL
Buffer PBS buffer with 2 % sucrose
Handling Advice Avoid repeated freeze-thaw cycles.
Storage -20 °C
Storage Comment For longer periods of storage, store at -20 °C
Background publications Rush, Moritz, Lee et al.: "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." in: Nature biotechnology, Vol. 23, Issue 1, pp. 94-101, 2005 (PubMed).

Hosts (13), (1)
Reactivities (14), (1), (1), (1), (1), (1)
Applications (14), (1), (1)
Epitopes (5), (2), (1), (1), (1), (1)
back to top