Zinc Finger Protein 550 (ZNF550) (N-Term) antibody

Antigen: Zinc Finger Protein 550 (ZNF550)

Synonyms: MGC41917

Binding Site: N-Term

Clonality: Polyclonal

Host: Rabbit

Reactivity: Human

Application: Western Blotting (WB)

Catalog no.: ABIN972053

Additional Information

Alternative name: ZNF550

Gene ID: ZNF550

Immunogen: The immunogen for anti-ZNF550 antibody: synthetic peptide directed towards the N terminal of human ZNF550

Sequence: LLVSLGDRAQVHTREPTTYPPVLSERAFLRGSLTLESSTS SDSRLGRARD

Format: Lyophilized

Reconstitution: Add 50 µl of distilled water. Final anti-ZNF550 antibody concentration is 1 mg/ml.

Description: ZNF550 belongs to the krueppel C2H2-type zinc-finger protein family. It contains 8 C2H2-type zinc fingers and 1 KRAB domain. ZNF550 may be involved in transcriptional regulation.

Characteristics: Antigen Size: 381 amino acids

Molecular Weight: 44kDa

Application Details

Application Notes: WB Suggested Anti-ZNF550 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart.

Purification: Affinity Purified

Buffer: PBS

Storage (Long Term): For longer periods of storage, store at -20°C. Avoid repeat freeze-thaw cycles.

Storage (Short Term): Any unfrozen and/or unused material can be stored at 4°C for short term use (< 1 week), and should not be re-frozen.

Restrictions: For Research Use only

Images

WB Suggested Anti-ZNF550 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:1562500
Positive Control: Human heart

Publications

Product: Rush, Moritz, Lee et al.: "Immunoaffinity profiling of tyrosine phosphorylation in cancer cells." in: Nature biotechnology, Vol. 23, Issue 1, pp. 94-101, 2005 (PubMed).