BNP antibody (AA 1-32)

Catalog No. ABIN108756

The Mouse Monoclonal anti-BNP antibody has been validated for ELISA. It is suitable to detect BNP in samples from Human.

Quick Overview for BNP antibody (AA 1-32) (ABIN108756)

Target: BNP (Brain Natriuretic Peptide (BNP))

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This BNP antibody is un-conjugated

Application: ELISA

Clone: 7-13

Product Details anti-BNP Antibody

Binding Specificity: AA 1-32

Specificity: Synthetic human BNP (aa 1-32) Human proBNP (aa 1-108), recombinant

Immunogen: Synthetic human BNP (aa 1-32) KLH conjugated (spkmvqgsgcfgrkmdrissssglgckvlrrh)

Isotype: IgG1

Application Details

Application Notes: ELISA This antibody has not been tested for use in all applications. This does not necessarily exclude its use for non-tested procedures. The stated dilutions are recommendations only. We suggest that the applicant titrates the antibody in his/her system using appropriate negative/positive controls.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Resuspend in aqua bidest.

Storage: 4 °C

Target Details for BNP

Target: BNP (Brain Natriuretic Peptide (BNP))

Alternative Name: Brain Natriuretic Peptide

Background: Cell culture supernatant protein G purified in PBS pH 74

Pathways: Hormone Activity