CGRP antibody
-
- Target See all CGRP (CALCA) Antibodies
- CGRP (CALCA) (Calcitonin-Related Polypeptide alpha (CALCA))
-
Reactivity
- Human
-
Host
- Goat
-
Clonality
- Polyclonal
-
Conjugate
- This CGRP antibody is un-conjugated
-
Application
- Radioimmunoassay (RIA)
- Specificity
- Human Calcitonin Gene-related Peptide There were no cross reactivities obtained with human and salmon Katacalcin and Calcitonin
- Immunogen
- Synthetic human Calcitonin Gene-related Peptide, bTG-conjugated (acntatcvthrlagllsrsggmvksnfvptnvgskaf)
- Top Product
- Discover our top product CALCA Primary Antibody
-
anti-Calcitonin-Related Polypeptide alpha (CALCA) (AA 1-141) antibody
CALCA Reactivity: Human WB, IF Host: Rabbit Polyclonal unconjugated
anti-Calcitonin-Related Polypeptide alpha (CALCA) (AA 1-130) antibodyCALCA Reactivity: Mouse WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Calcitonin-Related Polypeptide alpha (CALCA) (AA 52-141) antibodyCALCA Reactivity: Human ELISA, WB Host: Mouse Monoclonal 4B10 unconjugated
anti-Calcitonin-Related Polypeptide alpha (CALCA) (AA 1-141) antibodyCALCA Reactivity: Human WB, IHC Host: Rabbit Polyclonal unconjugated
anti-Calcitonin-Related Polypeptide alpha (CALCA) (AA 1-134) antibodyCALCA Reactivity: Rat WB, IHC, IP, ICC Host: Rabbit Polyclonal unconjugated
anti-Calcitonin-Related Polypeptide alpha (CALCA) (AA 65-130) antibodyCALCA Reactivity: Human, Rat ELISA, WB, IHC (p), IF (cc), IF (p), IHC (fro) Host: Rabbit Polyclonal unconjugated
anti-Calcitonin-Related Polypeptide alpha (CALCA) (Internal Region) antibodyCALCA Reactivity: Human, Rat, Mouse ELISA, WB, IHC, ICC, IF Host: Rabbit Polyclonal unconjugated
anti-Calcitonin-Related Polypeptide alpha (CALCA) (AA 56-83) antibodyCALCA Reactivity: Human WB, IHC (p) Host: Rabbit Polyclonal RB19409 unconjugated
anti-Calcitonin-Related Polypeptide alpha (CALCA) (AA 80-141) antibodyCALCA Reactivity: Human ELISA, WB Host: Rabbit Polyclonal unconjugated
anti-Calcitonin-Related Polypeptide alpha (CALCA) (AA 85-116) antibodyCALCA Reactivity: Dog ELISA, WB Host: Rabbit Polyclonal unconjugated
-
- Application Notes
- RIA (1/3,000)
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Resuspend in aqua bidest.
- Storage
- 4 °C
-
- Target
- CGRP (CALCA) (Calcitonin-Related Polypeptide alpha (CALCA))
- Alternative Name
- Calcitonin-Gene related Peptide (CALCA Products)
- Background
- Serum
- Gene ID
- 797
- Pathways
- Hormone Activity, cAMP Metabolic Process, Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, Skeletal Muscle Fiber Development, Feeding Behaviour
-
