CGRP antibody

Catalog No. ABIN109807

This Goat Polyclonal antibody specifically detects CGRP in RIA. It exhibits reactivity toward Human.

Quick Overview for CGRP antibody (ABIN109807)

Target: CGRP (CALCA) (Calcitonin-Related Polypeptide alpha (CALCA))

Reactivity: Human

Host: Goat

Clonality: Polyclonal

Conjugate: This CGRP antibody is un-conjugated

Application: Radioimmunoassay (RIA)

Product Details anti-CGRP Antibody

Specificity: Human Calcitonin Gene-related Peptide There were no cross reactivities obtained with human and salmon Katacalcin and Calcitonin

Immunogen: Synthetic human Calcitonin Gene-related Peptide, bTG-conjugated (acntatcvthrlagllsrsggmvksnfvptnvgskaf)

Application Details

Application Notes: RIA (1/3,000)

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Resuspend in aqua bidest.

Storage: 4 °C

Target Details for CGRP

Target: CGRP (CALCA) (Calcitonin-Related Polypeptide alpha (CALCA))

Alternative Name: Calcitonin-Gene related Peptide

Background: Serum

Gene ID: 797

Pathways: Hormone Activity, cAMP Metabolic Process, Myometrial Relaxation and Contraction, Regulation of G-Protein Coupled Receptor Protein Signaling, Skeletal Muscle Fiber Development, Feeding Behaviour