BNP32 antibody

Catalog No. ABIN1100299

This Rabbit Polyclonal antibody specifically detects BNP32 in ELISA, IHC, DB and IHC (p). It exhibits reactivity toward Human.

Quick Overview for BNP32 antibody (ABIN1100299)

Target: BNP32 (BNP 32) (Brain Natriuretic Peptide 32 (BNP 32))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This BNP32 antibody is un-conjugated

Application: ELISA, Immunohistochemistry (IHC), Dot Blot (DB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-BNP32 Antibody

Brand: IHC-plus™

Purification: Protein G purified

Immunogen: Synthetic peptide (Human BNP: NH2-CSPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH) conjugated with KLH

Type of Immunogen: Synthetic peptide - KLH conjugated

Isotype: IgG

Application Details

Application Notes: Approved: DB, ELISA (1:40000), IHC, IHC-P (10 μg/mL)

Comment:

Target Species of Antibody: Human

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Reconstitute at 1 mg/mL in PBS

Concentration: Lot specific

Buffer: Lyophilized from PBS. No preservative added

Preservative: Without preservative

Target Details for BNP32

Target: BNP32 (BNP 32) (Brain Natriuretic Peptide 32 (BNP 32))