SNF8 antibody (N-Term)

Catalog No. ABIN1109459

Product Details anti-SNF8 Antibody

Target: SNF8 (Vacuolar-sorting Protein SNF8 (SNF8))

Binding Specificity: N-Term

Reactivity: Human, Rat, Mouse, Cow, Dog, Zebrafish (Danio rerio), Xenopus laevis, Chicken

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SNF8 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Sequence: MHRRGVGAGAIAKKKLAEAKYKERGTVLAEDQLAQMSKQLDMFKTNLEEF

Cross-Reactivity (Details): Species reactivity (expected):Mouse, Rat, African clawed frog, Bovine, Dog, Chicken, ZebrafishSpecies reactivity (tested):Human

Purification: Purified on peptide immunoaffinity column

Immunogen: The immunogen for anti-EAP30 antibody: synthetic peptide directed towards the N terminal of human EAP30

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Handling

Reconstitution: Add 50 μL of distilled water

Handling Advice: Avoid repeated freezing and thawing.

Storage: -20 °C

Storage Comment: Store the lyophised antibody at -20 °C for up to one year. Store reconstitued antibody undiluted for one month or in aliquots at -20 °C long term.

Expiry Date: 12 months

Target Details for SNF8

Target: SNF8 (Vacuolar-sorting Protein SNF8 (SNF8))

Alternative Name: Vacuolar-Sorting Protein SNF8 (SNF8 Products)

Background: ELL encodes an RNA polymerase II transcription factor that undergoes frequent translocation in acute myeloid leukemia (AML). In addition to its elongation activity, ELL contains a novel type of RNA polymerase II interaction domain that is capable of repressing polymerase activity in promoter-specific transcription. EAP30 is a subunit of the ELL complex. EAP30 can interact with ELL and derepress ELL's inhibitory activity in vitro.SNF8, VPS25, and VPS36 form ESCRT-II (endosomal sorting complex required for transport II), a complex involved in endocytosis of ubiquitinated membrane proteins. SNF8, VPS25, and VPS36 are also associated in a multiprotein complex with RNA polymerase II elongation facto.Synonyms: EAP30, ELL-associated protein of 30 kDa, ESCRT-II complex subunit VPS22

Gene ID: 11267

NCBI Accession: NP_009172