PTH antibody (N-Term)

Catalog No. ABIN191957

This Mouse Monoclonal antibody specifically detects PTH in IHC (p), RIA, IHC (fro) and EIA. It exhibits reactivity toward Human.

Quick Overview for PTH antibody (N-Term) (ABIN191957)

Target: PTH (Parathyroid Hormone (PTH))

Reactivity: Human

Host: Mouse

Clonality: Monoclonal

Conjugate: This PTH antibody is un-conjugated

Application: Immunohistochemistry (Paraffin-embedded Sections) (IHC (p)), Radioimmunoassay (RIA), Immunohistochemistry (Frozen Sections) (IHC (fro)), Enzyme Immunoassay (EIA)

Clone: A1-64

Product Details anti-PTH Antibody

Binding Specificity: AA 1-38, N-Term

Specificity: This antibody detects PTH peptide (aa 15-25, 1-34, 1-38, 1-84, 7-84). There were no cross reactivities obtained with synthetic PTH (aa 1-3, 1-10, 4-16, 28-48, 39-84, 44-68, 53-84,), PTHrP (aa 1- 86).

Characteristics: Synonyms: Parathormone, Parathyrin

Purification: Affinity chromatography

Immunogen: Synthetic human PTH (aa 1-38) poly Lysin conjugatedAA Sequence: SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALG

Isotype: IgG1

Application Details

Application Notes: RIA (25 ng/mL). Immunohistochemistry (cryo-sections and paraffinsections, 2 μg/mL). ELISA (1 μg/mL).
Other applications not tested.
Optimal dilutions are dependent on conditions and should be determined by the user.

Restrictions: For Research Use only

Handling

Reconstitution: Restore in aqua bidest to 1 mg/mL.

Buffer: 50 mM TRIS, pH 7.4, 0.05 % Sodium Azide

Preservative: Sodium azide

Precaution of Use: This product contains sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Storage: 4 °C/-20 °C

Storage Comment: Store lyophilized at 2 - 8 °C and reconstituted at -20 °C. Avoid repeated freezing andthawing.
Shelf life: One year from despatch.

Expiry Date: 12 months

Target Details for PTH

Target: PTH (Parathyroid Hormone (PTH))

Alternative Name: Parathyroid Hormone / PTH

Target Type: Hormone

Background: Synonyms: Parathormone, Parathyrin

Gene ID: 5741

UniProt: P01270

Pathways: cAMP Metabolic Process, Regulation of Carbohydrate Metabolic Process