FOXL2 antibody (AA 81-113)

Catalog No. ABIN2269092

This anti-FOXL2 antibody is a Rabbit Polyclonal antibody detecting FOXL2 in WB. Suitable for Human.

Quick Overview for FOXL2 antibody (AA 81-113) (ABIN2269092)

Target: FOXL2 (Forkhead Box L2 (FOXL2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FOXL2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-FOXL2 Antibody

Binding Specificity: AA 81-113

Sequence: YQYIIAKFPF YEKNKKGWQN SIRHNLSLNE CFI

Cross-Reactivity: Human

Cross-Reactivity (Details): Calculated cross reactivity: Hu

Characteristics: FOXL2 (Forkhead Box Protein L2)

Purification: Purified by immunoaffinity chromatography.

Immunogen: Synthetic peptide corresponding to aa81-113, YQYIIAKFPFYEKNKKGWQNSIRHNLSLNECFI, from human FOXL2, coupled to carrier protein BSA.

Application Details

Application Notes: Optimal working conditions should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Reconstitute with 100 μL sterile ddH2O.

Buffer: Supplied as a lyophilized powder in 5 mg BSA, 0.9 mg sodium chloride, 0.2 mg Na2HPO4, 0.05 mg Thimerosal, 0.05 mg sodium azide.

Preservative: Sodium azide, Thimerosal (Merthiolate)

Precaution of Use: This product contains Sodium azide and Thimerosal (Merthiolate): POISONOUS AND HAZARDOUS SUBSTANCES which should be handled by trained staff only.

Storage: -20 °C

Storage Comment: -20°C

Target Details for FOXL2

Target: FOXL2 (Forkhead Box L2 (FOXL2))

Alternative Name: FOXL2

UniProt: P58012

Pathways: Nuclear Hormone Receptor Binding, Positive Regulation of Endopeptidase Activity