Human Immunodeficiency Virus Transmembrane Glycoprotein (HIV gp41) antibody

Catalog No. ABIN2473862

The Goat Polyclonal anti-not_set antibody has been validated for ELISA and WB. It is suitable to detect not_set in samples from Human Immunodeficiency Virus (HIV).

Quick Overview for Human Immunodeficiency Virus Transmembrane Glycoprotein (HIV gp41) antibody (ABIN2473862)

Target: Human Immunodeficiency Virus Transmembrane Glycoprotein (HIV gp41)

Reactivity: Human Immunodeficiency Virus (HIV)

Host: Goat

Clonality: Polyclonal

Conjugate: Un-conjugated

Application: ELISA, Western Blotting (WB)

Product Details

Characteristics: Purified IgG

Purification: Purified

Immunogen: Synthetic peptide CH3CO-YTSLIHSLIEESQNQQEKNEQELLELDKWASLWNWF-NH2

Isotype: IgG

Application Details

Application Notes: Optimal working dilution should be determined by the investigator.

Restrictions: For Research Use only

Handling

Format: Liquid

Concentration: 1.0 mg/mL

Target Details

Target: Human Immunodeficiency Virus Transmembrane Glycoprotein (HIV gp41)

Alternative Name: Gp41

Target Type: Viral Protein

Background: Synonyms: HIV-1

UniProt: Q70626