MGST1 antibody (N-Term)

Catalog No. ABIN3042364

Product Details anti-MGST1 Antibody

Target: MGST1 (Microsomal Glutathione S-Transferase 1 (MGST1))

Binding Specificity: AA 42-75, N-Term

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MGST1 antibody is un-conjugated

Application: Western Blotting (WB)

Purpose: Rabbit IgG polyclonal antibody for Microsomal glutathione S-transferase 1(MGST1) detection. Tested with WB in Human,Mouse,Rat.

Sequence: KVFANPEDCV AFGKGENAKK YLRTDDRVER VRRA

Cross-Reactivity (Details): No cross reactivity with other proteins.

Characteristics: Rabbit IgG polyclonal antibody for Microsomal glutathione S-transferase 1(MGST1) detection. Tested with WB in Human,Mouse,Rat.
Gene Name: microsomal glutathione S-transferase 1
Protein Name: Microsomal glutathione S-transferase 1

Purification: Immunogen affinity purified.

Immunogen: A synthetic peptide corresponding to a sequence at the N-terminus of human MGST1 (42-75aa KVFANPEDCVAFGKGENAKKYLRTDDRVERVRRA), different from the related mouse sequence by six amino acids, and from the related rat sequence by five amino acids.

Isotype: IgG

Application Details

Application Notes: WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users.

Comment:

Antibody can be supported by chemiluminescence kit ABIN921124 in WB.

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.

Concentration: 500 μg/mL

Buffer: Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.

Preservative: Sodium azide

Precaution of Use: This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.

Handling Advice: Avoid repeated freezing and thawing.

Storage: 4 °C/-20 °C

Storage Comment: At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.

Target Details for MGST1

Target: MGST1 (Microsomal Glutathione S-Transferase 1 (MGST1))

Alternative Name: MGST1 (MGST1 Products)

Background: Microsomal glutathione S-transferase 1 is an enzyme that in humans is encoded by the MGST1 gene. The MAPEG (Membrane Associated Proteins in Eicosanoid and Glutathione metabolism) family consists of six human proteins, two of which are involved in the production of leukotrienes and prostaglandin E, important mediators of inflammation. Other family members, demonstrating glutathione S-transferase and peroxidase activities, are involved in cellular defense against toxic, carcinogenic, and pharmacologically active electrophilic compounds. This gene encodes a protein that catalyzes the conjugation of glutathione to electrophiles and the reduction of lipid hydroperoxides. This protein is localized to the endoplasmic reticulum and outer mitochondrial membrane where it is thought to protect these membranes from oxidative stress. Several transcript variants, some non-protein coding and some protein coding, have been found for this gene.

Synonyms: MGST1 antibody|Glutathione S transferase 12 antibody|GST12 antibody|MGST 1 antibody|MGST antibody|MGST1 antibody|MGST1_HUMAN antibody| Microsomal glutathione S-transferase 1 antibody|Microsomal GST 1 antibody|Microsomal GST-1 antibody|Microsomal GST-I antibody

Gene ID: 4257

UniProt: P10620