TICAM1 antibody (N-Term)
-
- Target See all TICAM1 Antibodies
- TICAM1 (Toll-Like Receptor Adaptor Molecule 1 (TICAM1))
-
Binding Specificity
- AA 53-84, N-Term
-
Reactivity
- Mouse
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TICAM1 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for TIR domain-containing adapter molecule 1(TICAM1) detection. Tested with WB in Mouse.
- Sequence
- QDTEARVSLE SLKMNTVAQL VAHQWADMET TE
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for TIR domain-containing adapter molecule 1(TICAM1) detection. Tested with WB in Mouse.
Gene Name: toll-like receptor adaptor molecule 1
Protein Name: TIR domain-containing adapter molecule 1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of mouse TRIF (53-84aa QDTEARVSLESLKMNTVAQLVAHQWADMETTE), different from the related human sequence by twelve amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product TICAM1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Mouse
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
-
Curcumin exerts anti-inflammatory and antioxidative properties in 1-methyl-4-phenylpyridinium ion (MPP(+))-stimulated mesencephalic astrocytes by interference with TLR4 and downstream signaling ..." in: Cell stress & chaperones, Vol. 21, Issue 4, pp. 697-705, (2017) (PubMed).
: "
-
Curcumin exerts anti-inflammatory and antioxidative properties in 1-methyl-4-phenylpyridinium ion (MPP(+))-stimulated mesencephalic astrocytes by interference with TLR4 and downstream signaling ..." in: Cell stress & chaperones, Vol. 21, Issue 4, pp. 697-705, (2017) (PubMed).
-
- Target
- TICAM1 (Toll-Like Receptor Adaptor Molecule 1 (TICAM1))
- Alternative Name
- TICAM1 (TICAM1 Products)
- Background
-
TICAM1 (TIR DOMAIN-CONTAINING ADAPTOR MOLECULE 1), also known as TRIF, is an adapter in responding to activation of toll-like receptors (TLRs). It mediates the rather delayed cascade of two TLR-associated signaling cascades, where the other one is dependent upon a MyD88 adapter. By genomic sequence analysis, Oshiumi et al. (2003) mapped the TICAM1 gene to chromosome 19p13.3. By coimmunoprecipitation analysis, Oshiumi et al. (2003) showed that TICAM1 interacts specifically with TLR3, but not with other TLRs. Functional analysis showed that the association of TLR3 and TICAM1 mediates dsRNA activation of IFNB, through NFKB, AP1, or IRF3. TICAM1 activation of NFKB was found to occur predominantly through IRAK1 rather than IRAK2. Small interfering (si)RNA blockage of TICAM1, just upstream of the TIR domain, reduced IFNB production in response to dsRNA.
Synonyms: MGC35334 antibody|Proline rich vinculin and TIR domain containing protein B antibody|Proline-rich antibody|PRVTIRB antibody|Putative NF kappa B activating protein 502H antibody|Putative NF-kappa-B-activating protein 502H antibody|Putative NFkB activating protein antibody|TCAM1_HUMAN antibody|TICAM 1 antibody|TICAM-1 antibody|TICAM1 antibody|TIR domain containing adapter molecule 1 antibody|TIR domain containing adapter protein inducing IFN beta antibody|TIR domain containing adaptor inducing interferon beta antibody|TIR domain-containing adapter molecule 1 antibody|TIR domain-containing adapter protein inducing IFN-beta antibody|Toll interleukin 1 receptor domain containing adapter protein inducing interferon beta antibody|Toll like receptor adaptor molecule 1 antibody|Toll-interleukin-1 receptor domain-containing adapter protein inducing interferon beta antibody|TRIF antibody|TRIF protein antibody| vinculin and TIR domain-containing protein B antibody - Gene ID
- 106759
- Pathways
- TLR Signaling, Activation of Innate immune Response, Cellular Response to Molecule of Bacterial Origin, Hepatitis C, Toll-Like Receptors Cascades
-