PTP4A2 antibody (N-Term)
-
- Target See all PTP4A2 Antibodies
- PTP4A2 (Protein tyrosine Phosphatase Type IVA, Member 2 (PTP4A2))
-
Binding Specificity
- AA 40-69, N-Term
- Reactivity
- Human, Mouse, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This PTP4A2 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Protein tyrosine phosphatase type IVA 2(PTP4A2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
- Sequence
- TTLVRVCDAT YDKAPVEKEG IHVLDWPFDD
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Protein tyrosine phosphatase type IVA 2(PTP4A2) detection. Tested with WB, IHC-P in Human,Mouse,Rat.
Gene Name: protein tyrosine phosphatase type IVA, member 2
Protein Name: Protein tyrosine phosphatase type IVA 2 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human PTP4A2 (40-69aa TTLVRVCDATYDKAPVEKEGIHVLDWPFDD), identical to the related mouse and rat sequences.
- Isotype
- IgG
- Top Product
- Discover our top product PTP4A2 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human, Mouse, Rat
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- PTP4A2 (Protein tyrosine Phosphatase Type IVA, Member 2 (PTP4A2))
- Alternative Name
- PTP4A2 (PTP4A2 Products)
- Background
-
Protein tyrosine phosphatase type IVA 2 is an enzyme that in humans is encoded by the PTP4A2 gene. The protein encoded by this gene belongs to a small class of the protein tyrosine phosphatase (PTP) family. PTPs are cell signaling molecules that play regulatory roles in a variety of cellular processes. PTPs in this class contain a protein tyrosine phosphatase catalytic domain and a characteristic C-terminal prenylation motif. This PTP has been shown to primarily associate with plasmic and endosomal membrane through its C-terminal prenylation. This PTP was found to interact with the beta-subunit of Rab geranylgeranyltransferase II (beta GGT II), and thus may function as a regulator of GGT II activity. Overexpression of this gene in mammalian cells conferred a transformed phenotype, which suggested its role in tumorigenesis. Alternatively spliced transcript variants have been described. Related pseudogenes exist on chromosomes 11, 12 and 17.
Synonyms: BM 008 antibody|EC 3.1.3.48 antibody|HH 13 antibody|HH13 antibody|HH7 2 antibody|HU PP 1 antibody|HUPP 1 antibody|HUPP1 antibody|OV 1 antibody|OV1 antibody|phosphatase of regenerating liver 2 antibody|PRL 2 antibody|PRL2 antibody|Protein tyrosine phosphatase 4a2 antibody|protein tyrosine phosphatase IVA antibody|protein tyrosine phosphatase IVA2 antibody|Protein tyrosine phosphatase of regenerating liver 2 antibody|protein tyrosine phosphatase type IVA 2 antibody|Protein tyrosine phosphatase type IVA member 2 isoform 1 antibody|protein tyrosine phosphatase type IVA, member 2 antibody|PTP (CAAXII) antibody|ptp IV1a antibody|ptp IV1b antibody|PTP4A antibody|PTPCAAX2 antibody|TP4A2_HUMAN antibody - Gene ID
- 8073
- UniProt
- Q12974
-