TAP1 antibody (Middle Region)
-
- Target See all TAP1 Antibodies
- TAP1 (Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP1))
-
Binding Specificity
- AA 438-471, Middle Region
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This TAP1 antibody is un-conjugated
-
Application
- Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))
- Purpose
- Rabbit IgG polyclonal antibody for Antigen peptide transporter 1(TAP1) detection. Tested with WB, IHC-P in Human.
- Sequence
- RSFANEEGEA QKFREKLQEI KTLNQKEAVA YAVN
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Antigen peptide transporter 1(TAP1) detection. Tested with WB, IHC-P in Human.
Gene Name: transporter 1, ATP-binding cassette, sub-family B (MDR/TAP)
Protein Name: Antigen peptide transporter 1 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence in the middle region of human TAP1 (438-471aa RSFANEEGEAQKFREKLQEIKTLNQKEAVAYAVN), different from the related mouse sequence by eight amino acids, and from the related rat sequence by nine amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product TAP1 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
IHC-P: Concentration: 0.5-1 μg/mL, Tested Species: Human, Epitope Retrieval by Heat: Boiling the paraffin sections in 10 mM citrate buffer, pH 6.0, for 20 mins is required for the staining of formalin/paraffin sections.
Notes: Tested Species: Species with positive results. Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Antibody can be supported by chemiluminescence kit ABIN921124 in WB, supported by ABIN921231 in IHC(P).
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Handling Advice
- Avoid repeated freezing and thawing.
- Storage
- 4 °C/-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- TAP1 (Transporter 1, ATP-Binding Cassette, Sub-Family B (MDR/TAP) (TAP1))
- Alternative Name
- TAP1 (TAP1 Products)
- Background
-
Transporter associated with Antigen Processing 1 is a protein that in humans is encoded by the TAP1 gene. The membrane-associated protein encoded by this gene is a member of the superfamily of ATP-binding cassette (ABC) transporters. ABC proteins transport various molecules across extra- and intra-cellular membranes. And ABC genes are divided into seven distinct subfamilies (ABC1, MDR/TAP, MRP, ALD, OABP, GCN20, White). This protein is a member of the MDR/TAP subfamily. Members of the MDR/TAP subfamily are involved in multidrug resistance. The protein encoded by this gene is involved in the pumping of degraded cytosolic peptides across the endoplasmic reticulum into the membrane-bound compartment where class I molecules assemble. Mutations in this gene may be associated with ankylosing spondylitis, insulin-dependent diabetes mellitus, and celiac disease. Two transcript variants encoding different isoforms have been found for this gene.
Synonyms: ABC 17 antibody|ABC transporter MHC 1 antibody|ABC17 antibody|ABCB 2 antibody|ABCB2 antibody|Antigen peptide transporter 1 antibody| APT 1 antibody|APT1 antibody|ATP binding cassette sub family B (MDR/TAP) member 2 antibody|ATP binding cassette sub family B member 2 antibody|ATP binding cassette transporter antibody|ATP-binding cassette sub-family B member 2 antibody|D6S114E antibody|FLJ26666 antibody|FLJ41500 antibody|Peptide supply factor 1 antibody|Peptide transporter involved in antigen processing 1 antibody|Peptide transporter PSF 1 antibody|Peptide transporter PSF1 antibody|Peptide transporter TAP 1 antibody|Peptide transporter TAP1 antibody|PSF 1 antibody|PSF-1 antibody|PSF1 antibody|Really interesting new gene 4 protein antibody|RING 4 antibody|RING4 antibody|TAP 1 antibody| TAP1 antibody|TAP1*0102N antibody|TAP1_HUMAN antibody|TAP1N antibody|Transporter 1 ATP binding cassette sub family B (MDR/TAP) antibody|Transporter 1 ATP binding cassette sub family B antibody|Transporter associated with antigen processing antibody|Transporter ATP binding cassette major histocompatibility complex 1 antibody|Y3 antibody - Gene ID
- 6890
- UniProt
- Q03518
- Pathways
- Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process, Human Leukocyte Antigen (HLA) in Adaptive Immune Response
-