Fetuin A antibody

Catalog No. ABIN4950053

This anti-Fetuin A antibody is a Rabbit Polyclonal antibody detecting Fetuin A in WB, ELISA, FACS and IHC (p). Suitable for Human and Rat.

Quick Overview for Fetuin A antibody (ABIN4950053)

Target: Fetuin A (AHSG) (alpha-2-HS-Glycoprotein (AHSG))

Reactivity: Human, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This Fetuin A antibody is un-conjugated

Application: Western Blotting (WB), ELISA, Flow Cytometry (FACS), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-Fetuin A Antibody

Purification: Antigen affinity

Immunogen: Amino acids DDPETEEAALVAIDYINQNLPWGYKHTLNQIDE of human AHSG were used as the immunogen for the AHSG antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the AHSG antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL,FACS: 1-3 μg/10^6 cells,ELISA: 0.1-0.5 μg/mL (human protein tested)

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the AHSG antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for Fetuin A

Target: Fetuin A (AHSG) (alpha-2-HS-Glycoprotein (AHSG))

Alternative Name: Fetuin-A / AHSG

Background: Alpha-2-HS-glycoprotein (AHSG), also known as Fetuin-A, is a protein that in humans is encoded by the AHSG gene. Fetuin-A belongs to the fetuin class of plasma binding proteins and is more abundant in fetal than adult blood. Its gene is mapped to 3q27. The protein is commonly present in the cortical plate of the immature cerebral cortex and bone marrow hemopoietic matrix. It is involved in several functions, such as endocytosis, brain development and the formation of bone tissue.

UniProt: P02765