FABP1 (liver) antibody

Catalog No. ABIN4950973

The Rabbit Polyclonal anti-FABP1 (liver) antibody has been validated for WB and IHC (p). It is suitable to detect FABP1 (liver) in samples from Human, Mouse and Rat.

Quick Overview for FABP1 (liver) antibody (ABIN4950973)

Target: FABP1 (liver) (LBFABP) (Liver Basic Fatty Acid Binding Protein (LBFABP))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This FABP1 (liver) antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (Paraffin-embedded Sections) (IHC (p))

Product Details anti-FABP1 (liver) Antibody

Purification: Antigen affinity

Immunogen: Amino acids KYQLQSQENFEAFMKAIGLPEELIQKGKDIK of human FABP were used as the immunogen for the FABP antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the FABP antibody should be determined by the researcher.\. Western blot: 0.1-0.5 μg/mL,IHC (Paraffin): 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the FABP antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for FABP1 (liver)

Target: FABP1 (liver) (LBFABP) (Liver Basic Fatty Acid Binding Protein (LBFABP))

Alternative Name: FABP1 (liver)

Background: Fatty acid binding protein 1, liver, also known as FABP1 or FABPL, is a human gene locating at 2p11. FABP1 encodes the fatty acid binding protein found in liver. Fatty acid binding proteins are a family of small, highly conserved, cytoplasmic proteins that bind free fatty acids, their CoA derivatives, bilirubin, organic anions, and other small molecules. FABP1 and FABP6 (the ileal fatty acid binding protein) are also able to bind bile acids. It is thought that FABPs roles include fatty acid uptake, transport, and metaboism. The liver form of FABP may be identical to the major liver protein-1 (Lvp-1), which is encoded by a gene situated within 1 cM of Ly-2.

UniProt: P07148