HLA-DRB3 antibody (Major Histocompatibility Complex, Class II, DR beta 3) (AA 1-266) Primary Antibody
HLA-DRB3
Reactivity: Human
WB
Host: Rabbit
Polyclonal
camera_alt 2
Catalog No. ABIN516515
$350.67
Plus shipping costs $45.00
100 μg
local_shipping
Shipping to:
United States
Delivery in 11 to 12 Business Days
-
- Target
- Binding Specificity
- AA 1-266
- Reactivity
- Human
- Host
- Rabbit
- Clonality
- Polyclonal
- Conjugate
- This HLA-DRB3 antibody is un-conjugated
- Application
- Western Blotting (WB)
- Purpose
- Rabbit polyclonal antibody raised against a full-length human HLA-DRB3 protein.
- Brand
- MaxPab®
- Cross-Reactivity
- Human
- Immunogen
immunogen: HLA-DRB3 (NP_072049.2, 1 a.a. ~ 266 a.a) full-length human protein.
Immunogen Sequence: MVCLKLPGGSSLAALTVTLMVLSSRLAFAGDTRPRFLELRKSECHFFNGTERVRYLDRYFHNQEEFLRFDSDVGEYRAVTELGRPVAESWNSQKDLLEQKRGRVDNYCRHNYGVGESFTVQRRVHPQVTVYPAKTQPLQHHNLLVCSVSGFYPGSIEVRWFRNGQEEKAGVVSTGLIQNGDWTFQTLVMLETVPRSGEVYTCQVEHPSVTSALTVEWRARSESAQSKMLSGVGGFVLGLLFLGAGLFIYFRNQKGHSGLQPTGFLS
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
Product Quality tested by: Antibody reactive against mammalian transfected lysate.
- Restrictions
- For Research Use only
-
- Buffer
- In 1x PBS, pH 7.4
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
- Target
- Alternative Name
- HLA-DRB3 (HLA-DRB3 Antibody Abstract)
- Background
- Full Gene Name: major histocompatibility complex, class II, DR beta 3
Synonyms: HLA-DR3B,MGC117330 - Gene ID
- 3125
- NCBI Accession
- NP_072049, NM_022555
- Pathways
- TCR Signaling, Positive Regulation of Peptide Hormone Secretion, Production of Molecular Mediator of Immune Response, Cancer Immune Checkpoints, Human Leukocyte Antigen (HLA) in Adaptive Immune Response
You are here: