ZNHIT3 antibody (Zinc Finger, HIT-Type Containing 3) (AA 1-155) Primary Antibody
ZNHIT3
Reactivity: Human
IF, ELISA, WB
Host: Mouse
Monoclonal
2F8
camera_alt 4
Catalog No. ABIN522780
$440.00
Plus shipping costs $45.00
100 μg
local_shipping
Shipping to:
United States
Delivery in 11 to 12 Business Days
-
- Target
- Binding Specificity
- AA 1-155
- Reactivity
- Human
- Host
- Mouse
- Clonality
- Monoclonal
- Conjugate
- This ZNHIT3 antibody is un-conjugated
- Application
- Immunofluorescence (IF), ELISA, Western Blotting (WB)
- Purpose
- Mouse monoclonal antibody raised against a full-length recombinant ZNHIT3.
- Cross-Reactivity
- Human
- Immunogen
immunogen: ZNHIT3 (AAH17931, 1 a.a. ~ 155 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Immunogen Sequence: MASLKCSTVVCVICLEKPKYRCPACRVPYCSVVCFRKHKEQCNPETRPVEKKIRSALPTKTVKPVENKDDDDSIADFLNSDEEEDRVSLQNLKNLGESATLRSLLLNPHLRQLMVNLDQGEDKAKLMRAYMQEPLFVEFADCCLGIVEPSQNEES
- Clone
- 2F8
- Isotype
- IgG1 kappa
-
-
- Application Notes
- Optimal working dilution should be determined by the investigator.
- Comment
Product Quality tested by: Antibody Reactive Against Recombinant Protein.
- Restrictions
- For Research Use only
-
- Buffer
- In 1x PBS, pH 7.4
- Handling Advice
- Aliquot to avoid repeated freezing and thawing.
- Storage
- -20 °C
- Storage Comment
- Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
-
- Target
- Alternative Name
- ZNHIT3 (ZNHIT3 Antibody Abstract)
- Synonyms
- Myohd1, Trip3, TRIP3, TRIP-3, zinc finger, HIT type 3, zinc finger HIT-type containing 3, zinc finger, HIT-type containing 3, Znhit3, ZNHIT3
- Background
- Full Gene Name: zinc finger, HIT type 3
Synonyms: TRIP3 - Gene ID
- 9326
You are here: