ABCC11 antibody (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 11) (AA 1-553)

Details for Product anti-ABCC11 Antibody No. ABIN529876
Target
Binding Specificity
AA 1-553
11
9
7
4
3
3
2
1
1
1
1
1
1
1
1
Reactivity
Human
47
4
3
2
2
1
1
1
1
Host
Mouse
38
6
3
1
Clonality
Polyclonal
Conjugate
This ABCC11 antibody is un-conjugated
3
2
2
2
2
2
1
1
1
1
1
1
Application
Western Blotting (WB)
40
26
23
5
4
2
2
2
2
Options
Purpose Mouse polyclonal antibody raised against a full-length human ABCC11 protein.
Brand MaxPab®
Immunogen

immunogen: ABCC11 (AAH39085, 1 a.a. ~ 553 a.a) full-length human protein.

Immunogen Sequence: MTRKRTYWVPNSSGGLVNRGIDIGDDMVSGLIYKTYTLQDGPWSQQERNPEAPGRAAVPPWGKYDAALRTMIPFRPKPRFPAPQPLDNAGLFSYLTVSWLTPLMIQSLRSRLDENTIPPLSVHDASDKNVQRLHRLWEEEVSRRGIEKASVLLVMLRFQRTRLIFDALLGICFCIASVLGPILIIPKILEYSEEQLGNVVHGVGLCFALFLSECVKSLSFSSSWIINQRTAIRFRAAVSSFAFEKLIQFKSVIHITSGEAISFFTGDVNYLFEGVCYGPLVLITCASLVICSISSYFIIGYTAFIAILCYLLVFPLAVFMTRMAVKAQHHTSEVSDQRIRVTSEVLTCIKLIKMYTWEKPFAKIIEDLRRKERKLLEKCGLVQSLTSITLFIIPTVATAVWVLIHTSLKLKLTASMAFSMLASLNLLRLSVFFVPIAVKGLTNSKSAVMRFKKFFLQESPVFYVQTLQDPSKALVFEEATLSWQQTCPGIVNGALELERNGHASEGMTRPRDALGPEEEGNSLGPELHKINLVVSKVALFRPRRQASCQALRT

Cross-Reactivity Human
Target
Alternative Name ABCC11 (ABCC11 Antibody Abstract)
Background Full Gene Name: ATP-binding cassette, sub-family C (CFTR/MRP), member 11
Synonyms: EWWD,MRP8,WW
Gene ID 85320
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody reactive against mammalian transfected lysate.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 11 (ABCC11) (AA 1-553) antibody (ABIN529876) ABCC11 MaxPab polyclonal antibody. Western Blot analysis of ABCC11 expression in HepG2.
Image no. 2 for anti-ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 11 (ABCC11) (AA 1-553) antibody (ABIN529876) Western Blot analysis of ABCC11 expression in transfected 293T cell line by ABCC11 Ma...