ABCC11 antibody (ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 11) (AA 433-532)

Details for Product anti-ABCC11 Antibody No. ABIN529878
Target
Binding Specificity
AA 433-532
11
9
7
4
3
3
2
1
1
1
1
1
1
1
Reactivity
Human
46
4
3
2
2
1
1
1
1
Host
Mouse
38
5
3
1
Clonality (Clone)
Monoclonal ()
Conjugate
This ABCC11 antibody is un-conjugated
3
2
2
2
2
2
1
1
1
1
1
1
Application
Immunofluorescence (IF), ELISA, Western Blotting (WB)
39
26
22
5
4
2
2
2
1
Options
Purpose Mouse monoclonal antibody raised against a partial recombinant ABCC11.
Immunogen

immunogen: ABCC11 (NP_115972.2, 433 a.a. ~ 532 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: FVPIAVKGLTNSKSAVMRFKKFFLQESPVFYVQTLQDPSKALVFEEATLSWQQTCPGIVNGALELERNGHASEGMTRPRDALGPEEEGNSLGPELHKINL

Clone 4H6
Isotype IgG2a kappa
Cross-Reactivity Human
Target
Alternative Name ABCC11 (ABCC11 Antibody Abstract)
Background Full Gene Name: ATP-binding cassette, sub-family C (CFTR/MRP), member 11
Synonyms: EWWD,MRP8,WW
Gene ID 85320
NCBI Accession NP_115972, NM_032583
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 11 (ABCC11) (AA 433-532) antibody (ABIN529878) Detection limit for recombinant GST tagged ABCC11 is 0.1 ng/ml as a capture antibody.
Image no. 2 for anti-ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 11 (ABCC11) (AA 433-532) antibody (ABIN529878) Immunofluorescence of monoclonal antibody to ABCC11 on HeLa cell. [antibody concentra...
Image no. 3 for anti-ATP-Binding Cassette, Sub-Family C (CFTR/MRP), Member 11 (ABCC11) (AA 433-532) antibody (ABIN529878) Western Blot detection against Immunogen (36.74 KDa) .
Product cited in: Fuchs, Daniel, Sadeghi, Opelz, Naujokat: "Salinomycin overcomes ABC transporter-mediated multidrug and apoptosis resistance in human leukemia stem cell-like KG-1a cells." in: Biochemical and biophysical research communications, Vol. 394, Issue 4, pp. 1098-104, 2010 (PubMed).