Capping Protein (Actin Filament) Muscle Z-Line, alpha 3 (CAPZA3) (AA 200-299) antibody

Details for Product No. ABIN530156
Target
Binding Specificity
AA 200-299
5
4
2
2
1
Reactivity
Human
21
8
4
2
1
1
1
Host
Mouse
14
6
4
Clonality (Clone)
Monoclonal ()
Conjugate
Un-conjugated
1
1
1
1
1
1
1
Application
ELISA, Western Blotting (WB)
17
8
4
2
1
Options
Purpose Mouse monoclonal antibody raised against a partial recombinant CAPZA3.
Immunogen

immunogen: CAPZA3 (NP_201585, 200 a.a. ~ 299 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: NLHIEISKDLKESLEIVNQAQLALSFARLVEEQENKFQAAVLEELQELSNEALRKILRRDLPVTRTLIDWHRILSDLNLVMYPKLGYVIYSRSVLCNWII

Clone 4D6
Isotype IgG2a kappa
Cross-Reactivity Human, Rat (Rattus)
Target
Alternative Name CAPZA3 (CAPZA3 Antibody Abstract)
Background Full Gene Name: capping protein (actin filament) muscle Z-line, alpha 3
Synonyms: CAPPA3,Gsg3
Gene ID 93661
NCBI Accession NP_201585, NM_033328
Pathways Regulation of Actin Filament Polymerization
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Format Liquid
Buffer In ascites fluid
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-Capping Protein (Actin Filament) Muscle Z-Line, alpha 3 (CAPZA3) (AA 200-299) antibody (ABIN530156) CAPZA3 monoclonal antibody (M01A), clone 4D6. Western Blot analysis of CAPZA3 express...