SLC7A3 antibody (N-Term)
-
- Target See all SLC7A3 Antibodies
- SLC7A3 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 3 (SLC7A3))
-
Binding Specificity
- AA 1-30, N-Term
-
Reactivity
- Human
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This SLC7A3 antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purpose
- Rabbit IgG polyclonal antibody for Cationic amino acid transporter 3(SLC7A3) detection. Tested with WB in Human.
- Sequence
- MPWQAFRRFG QKLVRRRTLE SGMAETRLAR
- Cross-Reactivity (Details)
- No cross reactivity with other proteins.
- Characteristics
-
Rabbit IgG polyclonal antibody for Cationic amino acid transporter 3(SLC7A3) detection. Tested with WB in Human.
Gene Name: solute carrier family 7 member 3
Protein Name: Cationic amino acid transporter 3 - Purification
- Immunogen affinity purified.
- Immunogen
- A synthetic peptide corresponding to a sequence at the N-terminus of human SLC7A3 (1-30aa MPWQAFRRFGQKLVRRRTLESGMAETRLAR), different from the related mouse and rat sequences by four amino acids.
- Isotype
- IgG
- Top Product
- Discover our top product SLC7A3 Primary Antibody
-
-
- Application Notes
-
WB: Concentration: 0.1-0.5 μg/mL, Tested Species: Human
Notes: Tested Species: Species with positive results.
Other applications have not been tested. Optimal dilutions should be determined by end users. - Comment
-
Boster recommends Enhanced Chemiluminescent Kit with anti-Rabbit IgG (ABIN921124) for Western blot.
- Restrictions
- For Research Use only
-
- Format
- Lyophilized
- Reconstitution
- Add 0.2 mL of distilled water will yield a concentration of 500 μg/mL.
- Concentration
- 500 μg/mL
- Buffer
- Each vial contains 5 mg BSA, 0.9 mg NaCl, 0.2 mg Na2HPO4, 0.05 mg Sodium azide.
- Preservative
- Sodium azide
- Precaution of Use
- This product contains Sodium azide: a POISONOUS AND HAZARDOUS SUBSTANCE which should be handled by trained staff only.
- Storage
- 4 °C,-20 °C
- Storage Comment
-
At -20°C for one year. After reconstitution, at 4°C for one month.
It can also be aliquotted and stored frozen at -20 °C for a longer time. Avoid repeated freezing and thawing.
-
- Target
- SLC7A3 (Solute Carrier Family 7 (Cationic Amino Acid Transporter, Y+ System), Member 3 (SLC7A3))
- Alternative Name
- SLC7A3 (SLC7A3 Products)
- Background
-
Cationic amino acid transporter 3 is a protein that in humans is encoded by the SLC7A3 gene. This gene encodes a member of the solute carrier family 7. The encoded protein is a sodium-independent cationic amino acid transporter. Alternate splicing results in multiple transcripts that encoded the same protein. The International Radiation Hybrid Mapping Consortium mapped the SLC7A3 gene to the X chromosome.
Synonyms: Cationic amino acid transporter 3, CAT-3, CAT3, Cationic amino acid transporter y+, Solute carrier family 7 member 3, SLC7A3, ATRC3, CAT3 - Gene ID
- 84889
-