Protein Phosphatase 1, Catalytic Subunit, gamma Isoform (PPP1CC) (AA 1-323) antibody

Details for Product No. ABIN562347
Antigen
  • PP-1G
  • ppp1g
  • PP1
  • dis2m1
  • fe06g11
  • fi22e08
  • wu:fe06g11
  • wu:fi22e08
  • PP1C
  • PPP1G
  • Ppp1cc1
  • ppp1cc-a
  • protein phosphatase 1, catalytic subunit, gamma isozyme
  • protein phosphatase 1, catalytic subunit, gamma isoform
  • protein phosphatase 1 catalytic subunit gamma
  • protein phosphatase 1, catalytic subunit, gamma isozyme L homeolog
  • ppp1cc
  • Ppp1cc
  • PPP1CC
  • ppp1cc.L
Epitope
AA 1-323
14
10
8
8
7
4
4
3
2
2
1
1
1
1
1
Reactivity
Human
93
43
33
15
5
5
4
2
2
2
1
1
1
Host
Mouse
77
9
6
4
Clonality
Polyclonal
Conjugate
Un-conjugated
6
5
5
4
4
4
1
1
1
1
1
1
Application
ELISA, Western Blotting (WB)
83
50
20
8
3
3
2
1
1
1
1
Options
Purpose Mouse polyclonal antibody raised against a full-length recombinant PPP1CC.
Immunogen

immunogen: PPP1CC (AAH14073, 1 a.a. ~ 323 a.a) full-length recombinant protein with GST tag.

Immunogen Sequence: MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK

Cross-Reactivity Human
Antigen
Alternative Name PPP1CC (PPP1CC Antibody Abstract)
Background Full Gene Name: protein phosphatase 1, catalytic subunit, gamma isoform
Synonyms: PPP1G
Gene ID 5501
Pathways Cellular Glucan Metabolic Process, Lipid Metabolism
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Format Liquid
Buffer 50 % glycerol
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Protein Phosphatase 1, Catalytic Subunit, gamma Isoform (PPP1CC) (AA 1-323) antibody (ABIN562347) Western Blot detection against Immunogen (61.64 KDa) .
Did you look for something else?