Protein Phosphatase 1, Catalytic Subunit, gamma Isoform (PPP1CC) (AA 1-323) antibody

Details for Product No. ABIN562347
Target
Binding Specificity
AA 1-323
12
9
8
8
7
4
4
3
2
1
1
1
1
1
1
Reactivity
Human
67
32
21
12
4
4
3
2
2
2
1
1
1
Host
Mouse
60
4
3
2
Clonality
Polyclonal
Conjugate
Un-conjugated
6
5
5
4
4
4
1
1
1
1
1
1
Application
ELISA, Western Blotting (WB)
60
39
10
7
2
2
2
1
1
1
1
Options
Purpose Mouse polyclonal antibody raised against a full-length recombinant PPP1CC.
Immunogen

immunogen: PPP1CC (AAH14073, 1 a.a. ~ 323 a.a) full-length recombinant protein with GST tag.

Immunogen Sequence: MADLDKLNIDSIIQRLLEVRGSKPGKNVQLQENEIRGLCLKSREIFLSQPILLELEAPLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICLLLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCFNCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLWSDPDKDVLGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYEFFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILKPAEKKKPNATRPVTPPRGMITKQAKK

Cross-Reactivity Human
Target
Alternative Name PPP1CC (PPP1CC Antibody Abstract)
Background Full Gene Name: protein phosphatase 1, catalytic subunit, gamma isoform
Synonyms: PPP1G
Gene ID 5501
Pathways Cellular Glucan Metabolic Process, Lipid Metabolism
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Format Liquid
Buffer 50 % glycerol
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Images
Image no. 1 for anti-Protein Phosphatase 1, Catalytic Subunit, gamma Isoform (PPP1CC) (AA 1-323) antibody (ABIN562347) Western Blot detection against Immunogen (61.64 KDa) .