NOS2 antibody (AA 1088-1126)

Catalog No. ABIN5647389

This Rabbit Polyclonal antibody specifically detects NOS2 in WB. It exhibits reactivity toward Human.

Quick Overview for NOS2 antibody (AA 1088-1126) (ABIN5647389)

Target: NOS2 (Nitric Oxide Synthase 2, Inducible (NOS2))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This NOS2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-NOS2 Antibody

Binding Specificity: AA 1088-1126

Purification: Antigen affinity purified

Immunogen: Amino acids 1088-1126 (ARDVAHTLKQLVAAKLKLNEEQVEDYFFQLKSQKRYHED) from the human protein were used as the immunogen for the iNOS antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the iNOS antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the iNOS antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for NOS2

Target: NOS2 (Nitric Oxide Synthase 2, Inducible (NOS2))

Alternative Name: iNOS / NOS2

Background: Nitric oxide synthase, inducible is an enzyme that in humans is encoded by the NOS2 gene. Nitric oxide (NO) is a messenger molecule with diverse functions throughout the body. In the brain and peripheral nervous system, NO displays many properties of a neurotransmitter, it is implicated in neurotoxicity associated with stroke and neurodegenerative diseases, neural regulation of smooth muscle, including peristalsis, and penile erection. Three different NOS isoforms have been identified which fall into two distinct types, constitutive and inducible. The inducible NOS (iNOS) isoform is expressed in a variety of cell types and tissues in response to inflammatory agents and cytokines. The human iNOS (NOS2) gene is approximately 37 kb in length and consists of 26 exons and 25 introns. NOS2-derived NO is a prerequisite for cytokine signaling and function in innate immunity.

UniProt: P35228

Pathways: Retinoic Acid Receptor Signaling Pathway, Cellular Response to Molecule of Bacterial Origin, Inositol Metabolic Process, Regulation of Leukocyte Mediated Immunity, Positive Regulation of Immune Effector Process