DVL2 antibody (AA 35-64)

Catalog No. ABIN5647553

This anti-DVL2 antibody is a Rabbit Polyclonal antibody detecting DVL2 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for DVL2 antibody (AA 35-64) (ABIN5647553)

Target: DVL2 (Dishevelled, Dsh Homolog 2 (Drosophila) (DVL2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This DVL2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-DVL2 Antibody

Binding Specificity: AA 35-64

Purification: Antigen affinity purified

Immunogen: Amino acids 35-64 (AERITLGDFKSVLQRPAGAKYFFKSMDQDF) from the human protein were used as the immunogen for the Dishevelled 2 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the Dishevelled 2 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Dishevelled 2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for DVL2

Target: DVL2 (Dishevelled, Dsh Homolog 2 (Drosophila) (DVL2))

Alternative Name: Dishevelled 2 / DVL2

Background: Segment polarity protein dishevelled homolog DVL-2 is a protein that in humans is encoded by the DVL2 gene. This gene encodes a member of the dishevelled (dsh) protein family. The vertebrate dsh proteins have approximately 40 % amino acid sequence similarity with Drosophila dsh. This gene encodes a 90-kD protein that undergoes posttranslational phosphorylation to form a 95-kD cytoplasmic protein, which may play a role in the signal transduction pathway mediated by multiple Wnt proteins. The mechanisms of dishevelled function in Wnt signaling are likely to be conserved among metazoans.

UniProt: O14641

Pathways: Tube Formation