ADAM2 antibody (AA 231-274)

Catalog No. ABIN5647674

This Rabbit Polyclonal antibody specifically detects ADAM2 in WB. It exhibits reactivity toward Human, Mouse and Rat.

Quick Overview for ADAM2 antibody (AA 231-274) (ABIN5647674)

Target: ADAM2 (ADAM Metallopeptidase Domain 2 (ADAM2))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ADAM2 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-ADAM2 Antibody

Binding Specificity: AA 231-274

Purification: Antigen affinity purified

Immunogen: Amino acids 231-274 (WIDENKIATTGEANELLHTFLRWKTSYLVLRPHDVAFLLVYREK) from the human protein were used as the immunogen for the ADAM2 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the ADAM2 antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the ADAM2 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for ADAM2

Target: ADAM2 (ADAM Metallopeptidase Domain 2 (ADAM2))

Alternative Name: ADAM2

Background: ADAM2 (A Disintegrin and Metalloproteinase Domain 2), also known as FTNB or PH30, is an enzyme that in humans is encoded by the ADAM2 gene. This gene encodes a member of the ADAM (a disintegrin and metalloprotease domain) family. Members of this family are membrane-anchored proteins structurally related to snake venom disintegrins, and have been implicated in a variety of biological processes involving cell-cell and cell-matrix interactions, including fertilization, muscle development, and neurogenesis. This member is a subunit of an integral sperm membrane glycoprotein called fertilin, which plays an important role in sperm-egg interactions. This gene is mapped to 8p11.2.

UniProt: Q99965