ACADVL antibody (AA 538-576)
-
- Target See all ACADVL Antibodies
- ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))
-
Binding Specificity
- AA 538-576
-
Reactivity
- Human, Rat
-
Host
- Rabbit
-
Clonality
- Polyclonal
-
Conjugate
- This ACADVL antibody is un-conjugated
-
Application
- Western Blotting (WB)
- Purification
- Antigen affinity purified
- Immunogen
- Amino acids 538-576 (RALEQFATVVEAKLIKHKKGIVNEQFLLQRLADGAIDLY) from the human protein were used as the immunogen for the ACADVL antibody.
- Isotype
- IgG
- Top Product
- Discover our top product ACADVL Primary Antibody
-
-
- Application Notes
- Western blot: 0.5-1 μg/mL
- Restrictions
- For Research Use only
-
- Buffer
- 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water
- Storage
- -20 °C
- Storage Comment
- After reconstitution, the ACADVL antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.
-
- Target
- ACADVL (Acyl-CoA Dehydrogenase, Very Long Chain (ACADVL))
- Alternative Name
- ACADVL / VLCAD (ACADVL Products)
- Background
- Very long-chain specific acyl-CoA dehydrogenase, mitochondrial (VLCAD) is an enzyme that in humans is encoded by the ACADVL gene. The protein encoded by this gene is targeted to the inner mitochondrial membrane, where it catalyzes the first step of the mitochondrial fatty acid beta-oxidation pathway. This acyl-Coenzyme A dehydrogenaseis specific to long-chain and very-long-chain fatty acids. A deficiency in this gene product reduces myocardial fatty acid beta-oxidation and is associated with cardiomyopathy. Alternative splicing results in multiple transcript variants encoding different isoforms.
- UniProt
- P49748
- Pathways
- ER-Nucleus Signaling, Monocarboxylic Acid Catabolic Process
-