12-Lipoxygenase antibody (AA 186-231)

Catalog No. ABIN5647834

The Rabbit Polyclonal anti-12-Lipoxygenase antibody has been validated for WB. It is suitable to detect 12-Lipoxygenase in samples from Human, Mouse and Rat.

Quick Overview for 12-Lipoxygenase antibody (AA 186-231) (ABIN5647834)

Target: 12-Lipoxygenase (LOX12)

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This 12-Lipoxygenase antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-12-Lipoxygenase Antibody

Binding Specificity: AA 186-231

Purification: Antigen affinity purified

Immunogen: Amino acids 186-231 (ALKRVYTLLSSWNCLEDFDQIFWGQKSALAEKVRQCWQDDELFSYQ) from the human protein were used as the immunogen for the 12 Lipoxygenase antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the 12 Lipoxygenase antibody should be determined by the researcher.\. WB: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the 12 Lipoxygenase antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for 12-Lipoxygenase

Target: 12-Lipoxygenase (LOX12)

Alternative Name: 12 Lipoxygenase

Background: ALOX12 (Arachidonate 12-lipoxygenase) is an enzyme that in humans is encoded by the ALOX12 gene. By fluorescence in situ hybridization, the gene is located in band 17p13.1. The gene consists of 14 exons with 13 introns and spans approximately 15 kb of DNA Arachidonate 12-lipoxygenase introduces a molecular oxygen into the C-12 position of arachidonic acid to produce 12(S)-hydroperoxy-5,8,10,14-eicosatetraenoic acid. The major pathway of arachidonic acid metabolism in human platelets proceeds via a 12-lipoxygenase enzyme. Expression of the LOG12 gene was detected in human erythroleukemia cells, platelets, and human umbilical vein endothelial cells by reverse transcription-PCR analysis.

UniProt: P18054