PVRL4 antibody (AA 53-94)

Catalog No. ABIN5647906

The Rabbit Polyclonal anti-PVRL4 antibody has been validated for WB. It is suitable to detect PVRL4 in samples from Human.

Quick Overview for PVRL4 antibody (AA 53-94) (ABIN5647906)

Target: PVRL4 (Poliovirus Receptor-Related 4 (PVRL4))

Reactivity: Human

Host: Rabbit

Clonality: Polyclonal

Conjugate: This PVRL4 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-PVRL4 Antibody

Binding Specificity: AA 53-94

Purification: Antigen affinity purified

Immunogen: Amino acids 53-94 (FYRGDSGEQVGQVAWARVDAGEGAQELALLHSKYGLHVSPAY) from the human protein were used as the immunogen for the Nectin-4 antibody.

Isotype: IgG

Application Details

Application Notes: Western blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the Nectin-4 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for PVRL4

Target: PVRL4 (Poliovirus Receptor-Related 4 (PVRL4))

Alternative Name: Nectin-4 / PVRL4

Background: PVRL4, also known as Nectin-4, is expressed in human skin, hair follicles, and cultured keratinocytes, but not in fibroblasts. This gene encodes a member of the nectin family. The encoded protein contains two immunoglobulin-like (Ig-like) C2-type domains and one Ig-like V-type domain. It is involved in cell adhesion through trans-homophilic and -heterophilic interactions. It is a single-pass type I membrane protein. The soluble form is produced by proteolytic cleavage at the cell surface by the metalloproteinase ADAM17/TACE. The secreted form is found in both breast tumor cell lines and breast tumor patients. Mutations in this gene are the cause of ectodermal dysplasia-syndactyly syndrome type 1, an autosomal recessive disorder. Alternatively spliced transcript variants have been found but the full-length nature of the variant has not been determined.

UniProt: Q96NY8

Pathways: Cell-Cell Junction Organization