NEIL2 antibody (Nei Endonuclease VIII-Like 2 (E. Coli)) (AA 1-332)

Details for Product anti-NEIL2 Antibody No. ABIN566974
Antigen
Epitope
AA 1-332
11
10
8
5
2
1
1
1
Reactivity
Human
45
13
9
5
4
2
2
2
1
1
Host
Mouse
38
7
Clonality (Clone)
Monoclonal ()
Conjugate
This NEIL2 antibody is un-conjugated
3
2
2
2
2
2
1
1
1
1
1
1
Application
RNA Interference (RNAi), ELISA, Western Blotting (WB)
40
18
3
2
2
1
1
Options
Purpose Mouse monoclonal antibody raised against a full length recombinant NEIL2.
Immunogen

immunogen: NEIL2 (AAH13964, 1 a.a. ~ 332 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.

Immunogen Sequence: MPEGPLVRKFHHLVSPFVGQQVVKTGGSSKKLQPASLQSLWLQDTQVHGKKLFLRFDLDEEMGPPGSSPTPEPPQKEVQKEGAADPKQVGEPSGQKTLDGSSRSAELVPQGEDDSEYLERDAPAGDAGRWLRVSFGLFGSVWVNDFSRAKKANKRGDWRDPSPRLVLHFGGGGFLAFYNCQLSWSSSPVVTPTCDILSEKFHRGQALEALGQAQPVCYTLLDQRYFSGLGNIIKNEALYRAGIHPLSLGSVLSASRREVLVDHVVEFSTAWLQGKFQGRPQHTQVYQKEQCPAGHQVMKEAFGPEDGLQRLTWWCPQCQPQLSEEPEQCQFS

Clone 1B7
Isotype IgG1 kappa
Cross-Reactivity Human
Antigen
Alternative Name NEIL2 (NEIL2 Antibody Abstract)
Background Full Gene Name: nei like 2 (E. coli)
Synonyms: FLJ31644,MGC2832,MGC4505,NEH2,NEI2
Gene ID 252969
Pathways DNA Damage Repair
Application Notes Optimal working dilution should be determined by the investigator.
Comment

Product Quality tested by: Antibody Reactive Against Recombinant Protein.

Restrictions For Research Use only
Buffer In 1x PBS, pH 7.4
Handling Advice Aliquot to avoid repeated freezing and thawing.
Storage -20 °C
Storage Comment Store at -20°C or lower. Aliquot to avoid repeated freezing and thawing.
Supplier Images
Image no. 1 for anti-Nei Endonuclease VIII-Like 2 (E. Coli) (NEIL2) (AA 1-332) antibody (ABIN566974) Western Blot analysis of NEIL2 expression in transfected 293T cell line by NEIL2 mono...
Image no. 2 for anti-Nei Endonuclease VIII-Like 2 (E. Coli) (NEIL2) (AA 1-332) antibody (ABIN566974) Western blot analysis of NEIL2 over-expressed 293 cell line, cotransfected with NEIL2...
Image no. 3 for anti-Nei Endonuclease VIII-Like 2 (E. Coli) (NEIL2) (AA 1-332) antibody (ABIN566974) Detection limit for recombinant GST tagged NEIL2 is approximately 1ng/ml as a capture...
Image no. 4 for anti-Nei Endonuclease VIII-Like 2 (E. Coli) (NEIL2) (AA 1-332) antibody (ABIN566974) Western Blot detection against Immunogen (62.26 KDa) .