SP6 antibody

Catalog No. ABIN5708284

This anti-SP6 antibody is a Rabbit Polyclonal antibody detecting SP6 in WB. Suitable for Human, Mouse and Rat.

Quick Overview for SP6 antibody (ABIN5708284)

Target: SP6 (Sp6 Transcription Factor (SP6))

Reactivity: Human, Mouse, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This SP6 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-SP6 Antibody

Purification: Antigen affinity purified

Immunogen: Amino acids QPDMSHHYESWFRPTHPGAEDGSWWDLHPGTSWMDLPH from the human protein were used as the immunogen for the SP6 antibody.

Isotype: IgG

Application Details

Application Notes: Optimal dilution of the SP6 antibody should be determined by the researcher.\. Western Blot: 0.5-1 μg/mL

Restrictions: For Research Use only

Handling

Buffer: 0.5 mg/mL if reconstituted with 0.2 mL sterile DI water

Storage: -20 °C

Storage Comment: After reconstitution, the SP6 antibody can be stored for up to one month at 4°C. For long-term, aliquot and store at -20°C. Avoid repeated freezing and thawing.

Target Details for SP6

Target: SP6 (Sp6 Transcription Factor (SP6))

Alternative Name: SP6 / Transcription factor Sp6

Background: SP6 belongs to a family of transcription factors that contain 3 classical zinc finger DNA-binding domains consisting of a zinc atom tetrahedrally coordinated by 2 cysteines and 2 histidines (C2H2 motif). These transcription factors bind to GC-rich sequences and related GT and CACCC boxes. By somatic cell hybrid analysis and FISH, he SP6 gene is mapped t to chromosome 17q21.3-q22.

UniProt: Q3SY56