ANKRD11 antibody (N-Term)

Catalog No. ABIN629618

The Rabbit Polyclonal anti-ANKRD11 antibody has been validated for WB and IHC. It is suitable to detect ANKRD11 in samples from Human, Mouse, Rat and Dog.

Quick Overview for ANKRD11 antibody (N-Term) (ABIN629618)

Target: ANKRD11 (Ankyrin Repeat Domain 11 (ANKRD11))

Reactivity: Human, Mouse, Rat, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This ANKRD11 antibody is un-conjugated

Application: Western Blotting (WB), Immunohistochemistry (IHC)

Product Details anti-ANKRD11 Antibody

Binding Specificity: N-Term

Specificity: ANKRD11 antibody was raised against the N terminal of ANKRD11

Purification: Purified

Immunogen: ANKRD11 antibody was raised using the N terminal of ANKRD11 corresponding to a region with amino acids KRKLPFTAGANGEQKDSDTEKQGPERKRIKKEPVTRKAGLLFGMGLSGIR

Application Details

Application Notes: WB: 1.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

ANKRD11 Blocking Peptide, (ABIN940013), is also available for use as a blocking control in assays to test for specificity of this ANKRD11 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ANKRD11 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for ANKRD11

Target: ANKRD11 (Ankyrin Repeat Domain 11 (ANKRD11))

Alternative Name: ANKRD11

Background: ANKRD11 is a member of a novel family of ankyrin repeats containing cofactors (ANCOs) that interact with p160 coactivators to inhibit ligand-dependent transactivation. ANKRD11 encodes a large nuclear protein with five ankyrin repeats, and parts of its sequences have been reported as nasopharyngeal carcinoma susceptibility protein and medulloblastoma antigen. This gene also colocalizes and interacts with histone deacetylases.

Molecular Weight: 298 kDa (MW of target protein)