MAT1A antibody (C-Term)

Catalog No. ABIN629719

This Rabbit Polyclonal antibody specifically detects MAT1A in WB. It exhibits reactivity toward Human and Dog.

Quick Overview for MAT1A antibody (C-Term) (ABIN629719)

Target: MAT1A (Methionine Adenosyltransferase I, alpha (MAT1A))

Reactivity: Human, Dog

Host: Rabbit

Clonality: Polyclonal

Conjugate: This MAT1A antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-MAT1A Antibody

Binding Specificity: C-Term

Specificity: MAT1 A antibody was raised against the C terminal of MAT1

Purification: Purified

Immunogen: MAT1 A antibody was raised using the C terminal of MAT1 corresponding to a region with amino acids VAKSLVKAGLCRRVLVQVSYAIGVAEPLSISIFTYGTSQKTERELLDVVH

Application Details

Application Notes: WB: 2.5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

MAT1A Blocking Peptide, (ABIN5614679), is also available for use as a blocking control in assays to test for specificity of this MAT1A antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MAT0 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for MAT1A

Target: MAT1A (Methionine Adenosyltransferase I, alpha (MAT1A))

Alternative Name: MAT1A

Background: MAT1A catalyzes a two-step reaction that involves the transfer of the adenosyl moiety of ATP to methionine to form S-adenosylmethionine and tripolyphosphate, which is subsequently cleaved to PPi and Pi. S-adenosylmethionine is the source of methyl groups for most biological methylations. MAT1A is found as a homotetramer (MAT I) or a homodimer (MAT III) whereas a third form, MAT II (gamma), is encoded by the MAT2A gene. Mutations in its gene are associated with methionine adenosyltransferase deficiency.

Molecular Weight: 44 kDa (MW of target protein)

Pathways: Mitotic G1-G1/S Phases, M Phase, Ribonucleoside Biosynthetic Process, Methionine Biosynthetic Process