GINS1 antibody

Catalog No. ABIN629812

This Rabbit Polyclonal antibody specifically detects GINS1 in WB. It exhibits reactivity toward Human, Mouse, Dog and Rat.

Quick Overview for GINS1 antibody (ABIN629812)

Target: GINS1 (GINS Complex Subunit 1 (Psf1 Homolog) (GINS1))

Reactivity: Human, Mouse, Dog, Rat

Host: Rabbit

Clonality: Polyclonal

Conjugate: This GINS1 antibody is un-conjugated

Application: Western Blotting (WB)

Product Details anti-GINS1 Antibody

Purification: Purified

Immunogen: GINS1 antibody was raised using a synthetic peptide corresponding to a region with amino acids MFCEKAMELIRELHRAPEGQLPAFNEDGLRQVLEEMKALYEQNQSDVNEA

Application Details

Application Notes: WB: 5 µg/mL
Optimal conditions should be determined by the investigator.

Comment:

GINS1 Blocking Peptide, (ABIN5613762), is also available for use as a blocking control in assays to test for specificity of this GINS1 antibody

Restrictions: For Research Use only

Handling

Format: Lyophilized

Reconstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GINS1 antibody in PBS

Concentration: Lot specific

Buffer: PBS

Handling Advice: Avoid repeated freeze/thaw cycles.

Storage: 4 °C/-20 °C

Storage Comment: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Target Details for GINS1

Target: GINS1 (GINS Complex Subunit 1 (Psf1 Homolog) (GINS1))

Alternative Name: GINS1

Background: The GINS complex plays an essential role in the initiation of DNA replication.

Molecular Weight: 23 kDa (MW of target protein)

Pathways: DNA Replication, Synthesis of DNA